The BioAccord System With ACQUITY Premier for Improved Peptide CQA Monitoring

Applications | 2021 | WatersInstrumentation
LC/TOF, LC/HRMS, LC/MS
Industries
Pharma & Biopharma
Manufacturer
Waters

Summary

Importance of the Topic


Peptide-based multi-attribute methods (MAM) using LC-MS are transforming biotherapeutic quality assessment by enabling direct measurement of multiple critical quality attributes (CQAs) in a single assay. Robust chromatographic performance and consistent mass spectrometric response are essential to ensure accurate quantitation, particularly for low-abundance or metal-sensitive peptides that are prone to adsorption and signal loss on conventional stainless-steel surfaces.

Study Objectives and Overview


This application note compares the performance of a standard BioAccord System equipped with stainless-steel flow paths to the BioAccord System configured with the ACQUITY Premier UPLC featuring MaxPeak High Performance Surfaces (HPS) Technology. The primary goals were to evaluate improvements in acidic peptide recovery, assay sensitivity, reproducibility across a 3-order magnitude dynamic range, and overall suitability for peptide MAM workflows.

Methodology and Instrumentation


Sample preparation and chromatographic conditions were held constant while comparing two configurations:
  • BioAccord with ACQUITY UPLC I-Class PLUS (stainless-steel flow path)
  • BioAccord with ACQUITY Premier UPLC (inert MaxPeak HPS surfaces)

Both systems used CSH C18 columns matched to each flow path, operated at 60 °C with 0.1% formic acid in water (A) and acetonitrile (B). Detection employed a tunable UV detector and ACQUITY RDa mass spectrometer in positive ESI mode (m/z 50–2000). Data processing and attribute monitoring were performed using waters_connect with the Peptide MAM App and LC-MS Tool Kit.

Main Results and Discussion


The ACQUITY Premier configuration delivered at least a two-fold increase in MS signal intensity for acidic peptides such as the PENNY fragment from NISTmAb, revealing previously undetectable deamidation species. Improved recovery translated into richer b/y fragmentation spectra and enhanced confidence in automated peak assignments. When monitoring a panel of CQAs over 0.1–2.0 µg loadings, the Premier system maintained area-% reproducibility (%RSD ≤ 20% for most attributes), with sub-10% RSD for oxidation modifications. A linear dynamic range from 0.1 to 1.0 µg (R2=0.99) was established, enabling detection of glycopeptides at 0.08% relative abundance with %RSD ≈ 3% across five injections.

Benefits and Practical Applications


  • Enhanced recovery and peak shape for acidic, metal-sensitive peptides
  • Stable MS response at both high and low loading levels
  • Lower %RSD for monitored CQAs, improving assay precision
  • Broad spectral dynamic range spanning three orders of magnitude
  • Seamless integration with compliant-ready waters_connect informatics for automated workflows

Future Trends and Opportunities


Advances in inert surface chemistries and UHPLC hardware will continue to reduce analyte adsorption, enabling further sensitivity gains. Integration with real-time data analytics and expanded informatics capabilities may facilitate adaptive method optimization and deeper characterization of low-level modifications. The principles demonstrated here can be extended to other PTMs, host-cell proteins, and complex sample matrices in biopharmaceutical development.

Conclusion


The BioAccord System paired with ACQUITY Premier and MaxPeak HPS Technology offers a robust, high-performance platform for peptide MAM assays. By minimizing metal-surface interactions, it achieves superior peptide recovery, reproducibility, and dynamic range without altering existing RPLC-MS conditions, making it ideally suited for routine QC, method transfer, and lifecycle management of protein therapeutics.

References


  1. Rogers RS, et al. Development of a Quantitative Mass Spectrometry Multi-Attribute Method for Characterization, Quality Control Testing and Disposition of Biologics. mAbs. 2015;7(5):881–890.
  2. Rogstad S, Yan H, Wang X, et al. Multi-Attribute Method for Quality Control of Therapeutic Proteins. Analytical Chemistry. 2019 Nov;91(22):14170–14177.
  3. Heaton JC, McCalley DV. Some Factors That Can Lead to Poor Peak Shape in Hydrophilic Interaction Chromatography, and Possibilities for Their Remediation. Journal of Chromatography A. 2016;1427:37–44.
  4. Wakamatsu A, et al. A Severe Peak Tailing of Phosphate Compounds Caused by Interaction With Stainless-Steel Used for Liquid Chromatography and Electrospray Mass Spectrometry. Journal of Separation Science. 2005;28:1823–1830.
  5. Birdsall RE, Kellett J, Yu YQ, Chen W. Application of Mobile Phase Additives to Reduce Metal-Ion Mediated Adsorption of Non-Phosphorylated Peptides. Journal of Chromatography B. 2019;1126–1127.
  6. DeLano M, et al. Using Hybrid Organic-Inorganic Surface Technology to Mitigate Analyte Interactions With Metal Surfaces In UHPLC. Analytical Chemistry. 2021;93(14):5773–5781.
  7. Birdsall RE, Kellett J, Ippoliti S, Ranbaduge N, Lauber MA, Yu YQ, Chen W. Reducing Metal-Ion Mediated Adsorption of Acidic Peptides in RPLC-Based Assays Using Hybrid Silica Chromatographic Surfaces. Journal of Chromatography B. 2021;122700.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Multi-Attribute Methods for Biopharmaceutical Analysis
[ APPLICATION NOTEBOOK ] Multi-Attribute Methods for Biopharmaceutical Analysis Application Notes [ APPLICATION NOTEBOOK ] Introduction The adoption of LC-MS-based multi-attribute method (MAM) analysis for routine monitoring of biotherapeutic variation has progressed greatly over the last five years. The ability…
Key words
notebook, notebookattribute, attributebiopharmaceutical, biopharmaceuticalreturn, returnmulti, multimam, mamapplication, applicationcontents, contentspeptide, peptideattributes, attributesmethods, methodsacquity, acquitymab, mabbioaccord, bioaccordmonitoring
Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway
Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway Nilini Ranbaduge, Robert E Birdsall, Ying Qing Yu, Weibin Chen, Waters Corporation, Milford, MA Introduction Results Non-specific adsorption of acidic peptides to metal surfaces is a well-known phenomenon affecting…
Key words
eeqynstyr, eeqynstyrpennyk, pennykvvsvltvlhqdwlngk, vvsvltvlhqdwlngksystem, systemfluidic, fluidicbase, basesuccinimide, succinimidepeptide, peptideoxidation, oxidationmodification, modificationcqa, cqapeak, peakimproved, improveddeamidation, deamidationpeptides
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY Nilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin Chen Waters Corporation, 34 Maple street, MA, 01757, USA INTRODUCTION  The Peptide Multi-Attribute Method…
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngksuccinamide, succinamidebioaccord, bioaccordpremier, premieroxidation, oxidationpennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngq, gfypsdiavewesngqacquity, acquitymam, mamvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
BIOACCORD SYSTEM WITH ACQUITY PREMIER - Routine Biopharmaceutical  Analysis – Accelerated
[ BIOACCORD SYSTEM WITH ACQUITY PREMIER ] Routine Biopharmaceutical Analysis – Accelerated ACCESS | COMPLIANCE | QUALITY | EFFICIENCY [ BIOACCORD SYSTEM WITH ACQUITY PREMIER ] Improving lab efficiency without sacrificing results quality is critical, but that isn’t easy. Now…
Key words
bioaccord, bioaccordpremier, premieracquity, acquitysystem, systemdata, datapennyk, pennykachieve, achievequality, qualitycompliant, compliantconventional, conventionalminimizing, minimizingmam, mamproductive, productiveworkflows, workflowshps
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike