LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

The BioAccord System With ACQUITY Premier for Improved Peptide CQA Monitoring

 

Similar PDF

Toggle
[ APPLICATION NOTEBOOK ] Multi-Attribute Methods for Biopharmaceutical Analysis Application Notes [ APPLICATION NOTEBOOK ] Introduction The adoption of LC-MS-based multi-attribute method (MAM) analysis for routine monitoring of biotherapeutic variation has progressed greatly over the last five years. The ability…
Key words
notebook, notebookattribute, attributebiopharmaceutical, biopharmaceuticalreturn, returnmulti, multimam, mamcontents, contentsapplication, applicationpeptide, peptideattributes, attributesmethods, methodsacquity, acquitymab, mabbioaccord, bioaccordmonitoring
Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway Nilini Ranbaduge, Robert E Birdsall, Ying Qing Yu, Weibin Chen, Waters Corporation, Milford, MA Introduction Results Non-specific adsorption of acidic peptides to metal surfaces is a well-known phenomenon affecting…
Key words
eeqynstyr, eeqynstyrpennyk, pennykvvsvltvlhqdwlngk, vvsvltvlhqdwlngksystem, systemfluidic, fluidicbase, basepeptide, peptidesuccinimide, succinimideoxidation, oxidationmodification, modificationcqa, cqapeak, peakimproved, improveddeamidation, deamidationhps
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY Nilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin Chen Waters Corporation, 34 Maple street, MA, 01757, USA INTRODUCTION  The Peptide Multi-Attribute Method…
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngkpremier, premiersuccinamide, succinamidebioaccord, bioaccordoxidation, oxidationpennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngq, gfypsdiavewesngqacquity, acquitymam, mamvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
[ BIOACCORD SYSTEM WITH ACQUITY PREMIER ] Routine Biopharmaceutical Analysis – Accelerated ACCESS | COMPLIANCE | QUALITY | EFFICIENCY [ BIOACCORD SYSTEM WITH ACQUITY PREMIER ] Improving lab efficiency without sacrificing results quality is critical, but that isn’t easy. Now…
Key words
bioaccord, bioaccordpremier, premieracquity, acquitysystem, systemdata, datapennyk, pennykachieve, achievequality, qualitycompliant, compliantminimizing, minimizingconventional, conventionalmam, mamproductive, productiveworkflows, workflowshps
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike