BIOACCORD SYSTEM WITH ACQUITY PREMIER - Routine Biopharmaceutical Analysis – Accelerated

Brochures and specifications | 2021 | WatersInstrumentation
LC/TOF, LC/HRMS, LC/MS
Industries
Pharma & Biopharma
Manufacturer
Waters

Summary

Importance of the Topic


Liquid chromatography mass spectrometry is essential for quality control of biopharmaceutical products. Achieving high efficiency and robust data quality across multiple product attributes in a single assay addresses key industrial demands. Integrated systems that reduce complexity and training requirements can broaden access to LC MS in compliance environments.

Study Objectives and Overview


This document introduces the Waters BioAccord System combined with ACQUITY Premier to streamline routine biopharmaceutical analysis. It aims to demonstrate how integrated hardware, software, and guided workflows accelerate deployment and support multi attribute methods from intact mass to glycan profiling. The system is designed to deliver consistent, compliance ready data with minimal specialist intervention.

Methodology


The workflow leverages automated setup, intelligent monitoring through SmartMS, and outcome based application training. Guided protocols cover intact mass analysis, peptide mapping and multi attribute method development, released glycan profiling, and impurity measurement in proteins, peptides, and oligonucleotides. Data acquisition and processing occur within a single informatics platform offering audit trails and role based access.

Used Instrumentation

  • BioAccord LC MS System equipped with ACQUITY Premier UPLC
  • MaxPeak High Performance Surfaces to minimize metal surface adsorption
  • SmartMS software for automated health checks and diagnostics
  • waters_connect informatics platform for compliant data management

Main Results and Discussion


In comparative tests the ACQUITY Premier flow paths reduced peak broadening and improved recovery of metal sensitive peptides and oligonucleotides. Extracted ion chromatograms for a model peptide showed higher signal intensity and lower variability than conventional systems. Oligonucleotide impurity analysis revealed previously undetected low level species. Fragment ion spectra confirmed enhanced sensitivity and reproducibility across multiple product attributes.

Benefits and Practical Applications


The integrated system reduces setup time and training overhead, enabling existing staff to perform complex assays. Simultaneous detection, identification, and quantification accelerate decision making and lower operational risk. Compliance ready software supports audit trails, electronic records, and network deployment for regulated environments. Laboratories can adopt LC MS for QA QC release testing without major infrastructure changes.

Future Trends and Opportunities


As biopharmaceutical pipelines expand, demand for automated multi attribute analysis will grow. Advances in surface chemistries and informatics integration will further enhance throughput and data reliability. Future developments may include high throughput screening, real time monitoring in manufacturing, and expanded support for novel modalities such as lipid nanoparticles and mRNA fragments.

Conclusion


The BioAccord System with ACQUITY Premier delivers a robust, user friendly platform for routine biopharmaceutical LC MS analysis. By combining optimized hardware surfaces, guided workflows, and compliance ready informatics, it democratizes multi attribute testing and supports regulatory requirements while maintaining high data quality.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology Analytical Solutions Using MaxPeak High Performance Surfaces (HPS) Technology for Biopharmaceutical Therapeutics Biopharmaceutical therapeutics have consistently been the fastest growing segment within the pharmaceutical space and require advances…
Key words
premier, premieracquity, acquityglycan, glycanmaxpeak, maxpeaknucleotide, nucleotideculture, culturehps, hpspeptide, peptideintact, intactsystem, systembioaccord, bioaccordcolumn, columnread, readprotein, proteinglycans
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY Nilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin Chen Waters Corporation, 34 Maple street, MA, 01757, USA INTRODUCTION  The Peptide Multi-Attribute Method…
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngkpremier, premiersuccinamide, succinamidebioaccord, bioaccordoxidation, oxidationpennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykacquity, acquitygfypsdiavewesngq, gfypsdiavewesngqmam, mamvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway
Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway Nilini Ranbaduge, Robert E Birdsall, Ying Qing Yu, Weibin Chen, Waters Corporation, Milford, MA Introduction Results Non-specific adsorption of acidic peptides to metal surfaces is a well-known phenomenon affecting…
Key words
eeqynstyr, eeqynstyrpennyk, pennykvvsvltvlhqdwlngk, vvsvltvlhqdwlngksystem, systemfluidic, fluidicbase, basesuccinimide, succinimidepeptide, peptideoxidation, oxidationmodification, modificationcqa, cqapeak, peakimproved, improveddeamidation, deamidationhps
The BioAccord System With ACQUITY  Premier for Improved Peptide CQA  Monitoring
Application Note The BioAccord System With ACQUITY Premier for Improved Peptide CQA Monitoring Nilini Ranbaduge, Robert E. Birdsall, Ying Qing Yu, Weibin Chen Waters Corporation Abstract Peptide MAM is an LC-MS based assay for direct biotherapeutic product attribute analysis that…
Key words
bioaccord, bioaccordhps, hpsmaxpeak, maxpeakpremier, premiersurfaces, surfacesmam, mamacquity, acquitypeptide, peptideperformance, performanceacidic, acidicsystem, systemaspartic, asparticattribute, attributetechnology, technologyassay
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike