LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

BIOACCORD SYSTEM WITH ACQUITY PREMIER - Routine Biopharmaceutical Analysis – Accelerated

 

Similar PDF

Toggle
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology Analytical Solutions Using MaxPeak High Performance Surfaces (HPS) Technology for Biopharmaceutical Therapeutics Biopharmaceutical therapeutics have consistently been the fastest growing segment within the pharmaceutical space and require advances…
Key words
premier, premieracquity, acquityglycan, glycanmaxpeak, maxpeaknucleotide, nucleotideculture, culturehps, hpspeptide, peptideintact, intactsystem, systembioaccord, bioaccordread, readcolumn, columnprotein, proteinglycans
Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway Nilini Ranbaduge, Robert E Birdsall, Ying Qing Yu, Weibin Chen, Waters Corporation, Milford, MA Introduction Results Non-specific adsorption of acidic peptides to metal surfaces is a well-known phenomenon affecting…
Key words
eeqynstyr, eeqynstyrpennyk, pennykvvsvltvlhqdwlngk, vvsvltvlhqdwlngksystem, systemfluidic, fluidicbase, basesuccinimide, succinimidepeptide, peptideoxidation, oxidationmodification, modificationcqa, cqapeak, peakimproved, improveddeamidation, deamidationhps
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY Nilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin Chen Waters Corporation, 34 Maple street, MA, 01757, USA INTRODUCTION  The Peptide Multi-Attribute Method…
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngkpremier, premiersuccinamide, succinamideoxidation, oxidationbioaccord, bioaccordpennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngq, gfypsdiavewesngqacquity, acquitymam, mamvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
Application Note The BioAccord System With ACQUITY Premier for Improved Peptide CQA Monitoring Nilini Ranbaduge, Robert E. Birdsall, Ying Qing Yu, Weibin Chen Waters Corporation Abstract Peptide MAM is an LC-MS based assay for direct biotherapeutic product attribute analysis that…
Key words
bioaccord, bioaccordhps, hpspremier, premiermaxpeak, maxpeaksurfaces, surfacesmam, mamacquity, acquitypeptide, peptideperformance, performancesystem, systemacidic, acidicattribute, attributeaspartic, aspartictechnology, technologyassay
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike