Beyond TurboTMT: Phi-SDM Super-resolution Methods for Next-generation Highly-multiplexed Quantitative Ultrasensitive and Single-Cell Proteomics via TMTPro Complement Ion Deconvolution
Posters | 2021 | Thermo Fisher Scientific | ASMSInstrumentation
Single-cell proteomics reveals cellular heterogeneity critical for understanding biology, disease progression, and therapeutic responses. Achieving high multiplexing with accurate quantitation in low-input samples remains challenging due to limited ion currents and co-isolation artifacts.
This work investigates the application of phase-constrained spectrum deconvolution (Phi-SDM) focused on high-mass tandem mass tag complement (TMTc) ions, aiming to:
Phi-SDM directed at TMT complement ions significantly enhances resolution and quantitative accuracy in next-generation single-cell proteomics. This approach overcomes limitations of conventional eFT, offering an operational workflow for ultrasensitive, highly multiplexed analyses.
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Summary
Significance of the Topic
Single-cell proteomics reveals cellular heterogeneity critical for understanding biology, disease progression, and therapeutic responses. Achieving high multiplexing with accurate quantitation in low-input samples remains challenging due to limited ion currents and co-isolation artifacts.
Study Objectives and Overview
This work investigates the application of phase-constrained spectrum deconvolution (Phi-SDM) focused on high-mass tandem mass tag complement (TMTc) ions, aiming to:
- Enable ultra-high resolution deconvolution of nearly isobaric 15N/13C TMTc species.
- Improve quantitative accuracy in highly multiplexed single-cell analyses.
- Demonstrate operational workflows on commercial Orbitrap platforms.
Methodology and Instrumentation
- Sample preparation: SCoPE-MS style labeling of single-cell equivalents and carrier material with TMTPro reagents.
- LC-MS systems: Thermo Scientific Q Exactive HF-X with Evosep Plus nanoLC; Orbitrap Exploris 480 with Vanquish Neo UHPLC.
- Acquisition: Transients at nominal 120K and 240K resolution using eFT or Phi-SDM processing; ion fill-times up to 512 ms.
- Data analysis: Xcalibur software for spectrum visualization and deconvolution.
Main Results and Discussion
- Conventional eFT at 240K resolution fails to resolve 12 TMTProC species due to insufficient resolution.
- Phi-SDM on Exploris 480 achieves >600K empirical resolution, fully resolving 12 complement ions at 256 ms and 512 ms transients.
- On Q Exactive HF-X, Phi-SDM processing at 240K settings separated 12 species, eliminating co-isolation artifacts between carrier and single-cell channels.
- Partial peak splitting at 120K indicates the limits of lower transient lengths but confirms improved resolution over eFT.
Benefits and Practical Applications
- Accurate quantitation in multiplexed single-cell proteomics without reliance on MS3 workflows.
- Reduced co-isolation interference enhances sensitivity and quantitation precision.
- Compatibility with existing high-resolution Orbitrap platforms and standard SCoPE-MS workflows.
Future Trends and Potential Applications
- Integration of Phi-SDM across broader mass ranges to further streamline single-cell proteomics.
- Development of automated data pipelines for real-time deconvolution and quantitation.
- Extension to other isobaric labeling strategies and complex biological samples.
- Potential for clinical and pharmaceutical applications requiring ultrasensitive proteomic analysis.
Conclusion
Phi-SDM directed at TMT complement ions significantly enhances resolution and quantitative accuracy in next-generation single-cell proteomics. This approach overcomes limitations of conventional eFT, offering an operational workflow for ultrasensitive, highly multiplexed analyses.
Reference
- Budnik B., Levy E., Harmange G., et al. Mass spectrometry of single mammalian cells quantifies proteome heterogeneity during cell differentiation. Genome Biol. 2018;19:161.
- Specht H., Emmott E., Petelski A., et al. Single-cell proteomic and transcriptomic analysis of macrophage heterogeneity using SCoPE2. Genome Biol. 2021;22:50.
- Petelski A., Emmott E., Leduc A., et al. Multiplexed single-cell proteomics using SCoPE2. Nat. Protoc. (in press) 2021.
- Grinfeld D., Aizikov K., Kreutzmann A., Damoc E., Makarov A. Phase-Constrained Spectrum Deconvolution for Fourier Transform Mass Spectrometry. Anal. Chem. 2017;89(2):1202–1211.
- Kelstrup C.D., Aizikov K., Batth T.S., et al. Limits for Resolving Isobaric Tandem Mass Tag Reporter Ions Using Phi-SDM. J. Proteome Res. 2018;17(11):4008–4016.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Enhancing protein quantification and sample throughput with TMTpro 32-plex reagents and extended supporting features from the Thermo Scientific Orbitrap Ascend MultiOmics Tribrid Mass Spectrometer
2024|Thermo Fisher Scientific|Posters
Poster # P-I-0130 Enhancing protein quantification and sample throughput with TMTpro 32-plex reagents and extended supporting features from the Thermo Scientific Orbitrap Ascend MultiOmics Tribrid Mass Spectrometer Jingjing Huang1, Dustin Frost2, David Bergen1, Ryan D. Bomgarden2, Rosa Viner1, Graeme McAlister1,…
Key words
deuterated, deuteratedchannels, channelsagc, agcnormalized, normalizedreporter, reporterabundance, abundanceorbitrap, orbitrapquan, quanabundances, abundancesexlusion, exlusionnondeuterated, nondeuteratedeqsgtiylqhadeerek, eqsgtiylqhadeerekgavaedgdelrtepeak, gavaedgdelrtepeakvvadgaglpgedwvfvssk, vvadgaglpgedwvfvsskplexes
Grant application resource: Using the Orbitrap Exploris 480 mass spectrometer to accelerate fundamental research
2020|Thermo Fisher Scientific|Applications
WHITE PAPER 65659 Grant application resource: Using the Orbitrap Exploris 480 mass spectrometer to accelerate fundamental research Keywords: Single Cell Sensitivity, TMT & TMTpro Multiplexing, SureQuant Method, Quantitative Proteomics, Orbitrap Exploris 480 MS, FAIMS Pro interface, Mass Spectrometry Goal This…
Key words
faims, faimssurequant, surequantpro, prointerface, interfacetemplates, templatestmt, tmtboxcar, boxcarprm, prmdda, ddatargeted, targetedproteomics, proteomicsprotein, proteinquantitation, quantitationpeptides, peptidesacquisition
Expanding TMTpro reagents to 32-plex for high-throughput quantitative proteomics on Orbitrap platforms 
2024|Thermo Fisher Scientific|Posters
P-I-0120 Expanding TMTpro reagents to 32-plex for high-throughput quantitative proteomics on Orbitrap platforms Dustin Frost1, Joao A. Paulo2, Steven P. Gygi2, Karsten Kuhn3, Ian Pike3, Ryan Bomgarden1 2Harvard Medical School, Boston, MA, USA 3Proteome Sciences, London, UK Figure 8. TMTpro…
Key words
deuterated, deuteratedtmtpro, tmtproturbotmt, turbotmtquantified, quantifiedreferenced, referencedorbitrap, orbitrapchannels, channelslabeled, labeledsets, setspeptides, peptidesnon, nonhela, helathermo, thermoabundance, abundancescientific
Real-Time Search enables a new gold standard for TMT quantitation accuracy on the Orbitrap Eclipse Tribrid mass spectrometer
2020|Thermo Fisher Scientific|Applications
APPLICATION NOTE 65729 Real-Time Search enables a new gold standard for TMT quantitation accuracy on the Orbitrap Eclipse Tribrid mass spectrometer Authors: Aaron M. Robitaille1, Romain Huguet1, Ryan Bomgarden2, Jesse D. Canterbury1, Daniel Lopez-Ferrer1 Thermo Fisher Scientific, San Jose, CA…
Key words
search, searchtmt, tmtreal, realcomet, cometxcorr, xcorrsps, spstribrid, tribridorbitrap, orbitrapmass, masstime, timeeclipse, eclipsequantitation, quantitationinterference, interferenceaccuracy, accuracyengine