Analysis of Peptide/Protein*-Related Impurities Using the Integrated Solution of Bio 2D-LC/Q-TOF in Agilent MassHunter Software
Technical notes | 2022 | Agilent TechnologiesInstrumentation
Two-dimensional liquid chromatography (2D-LC) integrated with high-resolution mass spectrometry has emerged as a key analytical approach for resolving complex peptide and protein samples. The ability to separate closely related impurities, degradation products, and isomeric species is essential in biopharmaceutical characterization, quality control, and forced-degradation studies. Combining orthogonal chromatographic selectivities with accurate-mass detection expands both qualitative and quantitative insight into biomolecular mixtures, addressing critical needs in research, development, and regulatory compliance.
This technical overview demonstrates the integration of Bio 2D-LC workflows into the Agilent MassHunter LC/MS software, coupled with Q-TOF mass spectrometry, to detect and characterize related impurities of a forced-degraded peptide/protein model (bovine insulin). Key goals include illustrating software-driven methods for heart-cutting, comprehensive sampling modes, dynamic retention compensation, and gradient shifting, as well as assessing time savings and separation performance enhancements.
Samples of bovine insulin (1 mg/mL) were subjected to forced degradation (50 °C, pH 7 phosphate buffer, 5 days). The first dimension (1D) separation employed a Bio InfinityLab Poroshell HPH column (150 × 2.1 mm, 2.7 μm) with a shallow TFA gradient at 0.3 mL/min. Fractions were collected via a multiple heart-cutting (MHC) interface featuring active solvent modulation (ASM) and two sampling decks (12 loops total). The second dimension (2D) used a shorter Poroshell column (50 × 2.1 mm, 2.7 μm) with a formic acid gradient at 0.4 mL/min, interfaced to an Agilent 6545 Q-TOF with electrospray ionization. MassHunter software version 11.0 controlled 2D-LC cycles, peak-triggered sampling, dynamic peak parking, shifted gradients, and Multi-Inject operations.
High-resolution (HiRes) peak-based sampling resolved deamidated, desalanated, and intact insulin species. Multi-Inject mode reduced total 2D analysis time by ~30 min with negligible impact (<10%) on peak width and quantitative agreement within ±1%. Dynamic peak parking effectively compensated for 1D retention shifts, ensuring accurate fraction collection across runs. Shifted gradient experiments facilitated rapid method scouting in 2D by varying starting %B per heart-cut, achieving optimal resolution of three to four components within coeluting regions.
Continued advances in software-driven automation, including machine-learning–based peak recognition and real-time method optimization, will further streamline 2D-LC/MS workflows. Expanding 2D strategies to glycopeptide and high-molecular-weight protein assemblies, integrating ion-mobility separations, and coupling with novel detection modalities promise deeper structural insight and higher throughput in biopharmaceutical analysis.
The integration of Bio 2D-LC with Q-TOF mass spectrometry in Agilent MassHunter software enables comprehensive, high-resolution impurity analysis of peptide/protein samples. Key features such as dynamic peak parking, Multi-Inject, and shifted gradients deliver time savings and robust separation performance, supporting advanced method development and quality assurance in life-science laboratories.
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, 2D-LC
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Importance of the Topic
Two-dimensional liquid chromatography (2D-LC) integrated with high-resolution mass spectrometry has emerged as a key analytical approach for resolving complex peptide and protein samples. The ability to separate closely related impurities, degradation products, and isomeric species is essential in biopharmaceutical characterization, quality control, and forced-degradation studies. Combining orthogonal chromatographic selectivities with accurate-mass detection expands both qualitative and quantitative insight into biomolecular mixtures, addressing critical needs in research, development, and regulatory compliance.
Objectives and Study Overview
This technical overview demonstrates the integration of Bio 2D-LC workflows into the Agilent MassHunter LC/MS software, coupled with Q-TOF mass spectrometry, to detect and characterize related impurities of a forced-degraded peptide/protein model (bovine insulin). Key goals include illustrating software-driven methods for heart-cutting, comprehensive sampling modes, dynamic retention compensation, and gradient shifting, as well as assessing time savings and separation performance enhancements.
Methodology
Samples of bovine insulin (1 mg/mL) were subjected to forced degradation (50 °C, pH 7 phosphate buffer, 5 days). The first dimension (1D) separation employed a Bio InfinityLab Poroshell HPH column (150 × 2.1 mm, 2.7 μm) with a shallow TFA gradient at 0.3 mL/min. Fractions were collected via a multiple heart-cutting (MHC) interface featuring active solvent modulation (ASM) and two sampling decks (12 loops total). The second dimension (2D) used a shorter Poroshell column (50 × 2.1 mm, 2.7 μm) with a formic acid gradient at 0.4 mL/min, interfaced to an Agilent 6545 Q-TOF with electrospray ionization. MassHunter software version 11.0 controlled 2D-LC cycles, peak-triggered sampling, dynamic peak parking, shifted gradients, and Multi-Inject operations.
Used Instrumentation
- Agilent 1290 Infinity II Bio Multisampler, Dual Pumps, Multicolumn Thermostat, Diode Array Detector
- Agilent InfinityLab Bio 2D-LC Active Solvent Modulator and MHC Valves
- Agilent 6545 Q-TOF with Dual AJS ESI Source
- Columns: InfinityLab Poroshell HPH, 150 × 2.1 mm and 50 × 2.1 mm, 2.7 μm
Main Results and Discussion
High-resolution (HiRes) peak-based sampling resolved deamidated, desalanated, and intact insulin species. Multi-Inject mode reduced total 2D analysis time by ~30 min with negligible impact (<10%) on peak width and quantitative agreement within ±1%. Dynamic peak parking effectively compensated for 1D retention shifts, ensuring accurate fraction collection across runs. Shifted gradient experiments facilitated rapid method scouting in 2D by varying starting %B per heart-cut, achieving optimal resolution of three to four components within coeluting regions.
Benefits and Practical Applications
- Enhanced peak capacity and selectivity for complex peptide/protein impurity profiling
- Automated time- and peak-based sampling reduces operator burden and error risk
- Dynamic retention management ensures robust reproducibility across batches
- Multi-Inject and gradient-shifting workflows accelerate method development and throughput
Future Trends and Opportunities
Continued advances in software-driven automation, including machine-learning–based peak recognition and real-time method optimization, will further streamline 2D-LC/MS workflows. Expanding 2D strategies to glycopeptide and high-molecular-weight protein assemblies, integrating ion-mobility separations, and coupling with novel detection modalities promise deeper structural insight and higher throughput in biopharmaceutical analysis.
Conclusion
The integration of Bio 2D-LC with Q-TOF mass spectrometry in Agilent MassHunter software enables comprehensive, high-resolution impurity analysis of peptide/protein samples. Key features such as dynamic peak parking, Multi-Inject, and shifted gradients deliver time savings and robust separation performance, supporting advanced method development and quality assurance in life-science laboratories.
References
- De Vos J., et al. Anal. Sci. Adv. 2021;1:1–22.
- Stoll D., et al. Anal. Chem. 2015;87(16):8307–8315.
- Petersson P., Haselmann K., Buckenmaier S. J. Chromatogr. A 2016;1468:95–101.
- Pursch M., Buckenmaier S. Anal. Chem. 2015;87:5310–5317.
- Multidimensional LC Collaboration. 2D-LC Applications compendium.
- Car P., Stoll D. Two-Dimensional Liquid Chromatography. Agilent primer 2015.
- Buckenmaier S., et al. Chromatography Today 2015;20–26.
- Agilent Technologies. Nucleotide analysis comparability studies. App. note 2021.
- Woiwode U., et al. J. Chromatogr. A 2018;1562:69–77.
- Agilent 1290 Infinity II 2D-LC OpenLab and MassHunter User Guide 2021.
- Schweikart F., Hulthe G. Anal. Chem. 2019;91(3):1748–1751.
- Agilent Technologies. UV detector safety in biochemicals. Tech. overview 2021.
- Stoll D., et al. Anal. Chem. 2017;89:9260–9267.
- Petersson P. LC/GC North Am. 2019;37(10):2–6.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities
2025|Agilent Technologies|Applications
Application Note Biopharma/Pharma Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities Using an Agilent 1290 Infinity III bio 2D-LC and an Agilent 6545XT AdvanceBio LC/Q-TOF Authors Abstract Paramjeet Khandpur, Preeti Bharatiya, and Ashish Pargaonkar Agilent Technologies, Inc.…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgimpurities, impuritiespeptide, peptideaegtftsdvssylegqaakefiawlvrgrg, aegtftsdvssylegqaakefiawlvrgrgsequence, sequenceimpurity, impurityadvancebio, advancebiomass, massacquisition, acquisitionmodifications, modificationstruncated, truncatedpeptides, peptidesmhc, mhcseparation
High-Resolution Sampling 2D-LC for Pharmaceutical Impurity Analysis
2020|Agilent Technologies|Applications
High-Resolution Sampling 2D-LC for Pharmaceutical Impurity Analysis Detection of Impurities Hidden Under the API Peak at Relevant Levels Application Note Small Molecule Pharmaceuticals and Generics Authors Abstract Susanne Stephan and Sonja Krieger The analysis of impurities in low concentrations relative…
Key words
chlorodifluorobenzoic, chlorodifluorobenzoicdimension, dimensionwaste, wasteinsulin, insulinhdr, hdrtime, timediverter, diverterdad, dadimpurities, impuritiesdiode, diodeimpurity, impuritycuts, cutssampling, samplingarray, arrayfirst
Simultaneous Impurity Analysis and Enantioseparation of Atenolol Using Achiral-Chiral 2D-LC
2022|Agilent Technologies|Applications
Application Note Pharma & Biopharma Simultaneous Impurity Analysis and Enantioseparation of Atenolol Using Achiral-Chiral 2D-LC Author Lucas Willmann Agilent Technologies, Inc. Abstract To ensure the quality of drug products, chromatographic separation of synthetic byproducts from active pharmaceutical ingredients (APIs), as…
Key words
atenolol, atenololimpurity, impuritychiral, chiralseparation, separationchromatographic, chromatographicenantioseparation, enantioseparationcut, cutphase, phasemhc, mhcimpurities, impuritieshypotensive, hypotensiveenantiomeric, enantiomericreversed, reversedopenlab, openlabcds
The Agilent InfinityLab 2D-LC Solution with Active Solvent Modulation
2018|Agilent Technologies|Technical notes
Technical Overview The Agilent InfinityLab 2D-LC Solution with Active Solvent Modulation Achieving Improved Resolution and Sensitivity for Challenging Combinations of Separation Conditions Author Sonja Krieger Agilent Technologies, Inc. Abstract A major challenge during method development in two-dimensional liquid chromatography (2D-LC)…
Key words
asm, asmdeck, deckrplc, rplcbreakthrough, breakthroughfocusing, focusinggradient, gradientsolvent, solventcolumn, columneclipse, eclipsedimensional, dimensionalmodulation, modulationcapillaries, capillarieszorbax, zorbaxpeptides, peptidespartial