High-Resolution Sampling 2D-LC for Pharmaceutical Impurity Analysis

Applications | 2020 | Agilent TechnologiesInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, 2D-LC
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the topic


In pharmaceutical quality control, detecting impurities present at trace levels beneath a high-concentration active pharmaceutical ingredient (API) is critical for patient safety and regulatory compliance. Conventional one-dimensional (1D) liquid chromatography may fail to resolve coeluting impurities that differ by structural similarity and large concentration ratios. High-resolution sampling two-dimensional liquid chromatography (HiRes 2D-LC) addresses this challenge by fractionating the entire API peak from the first dimension into multiple narrow cuts, which are then separated in a second dimension to reveal hidden low-level impurities.

Objectives and overview of the study


This application note demonstrates the use of HiRes 2D-LC to detect impurities at or below 0.05% relative to the main API peak. Two model systems were investigated: mixtures of three chlorodifluorobenzoic acid isomers at relative concentrations ranging from 0.05% to 100%, and deamidated bovine insulin as a real-world example of a structurally related impurity. Key performance metrics—limit of quantification, accuracy, and precision—were evaluated under different detector configurations.

Methodology and instrumentation


The HiRes 2D-LC workflow comprises:
  • First dimension: Agilent 1290 Infinity II high-resolution reversed-phase separation of the sample peak.
  • Time-based sampling: Up to ten discrete 4–9 s cuts spanning the full width of the first-dimension peak are collected into 40 µL loops.
  • Second dimension: Fast gradient elution on a complementary column, with sequential analysis of each cut.
  • Detection: UV diode array detectors (DAD) with 10 mm cell or HDR-DAD solution for extended dynamic range; and coupling to an Agilent 6545 Q-TOF mass spectrometer using a diverter valve to exclude salt-rich fractions.

The main instrumentation included two high-speed pumps, a multisampler with cooling, multicolumn thermostats, DAD and HDR-DAD modules, a duo valve with multiple heart-cut loops, and, for MS experiments, an Agilent Jet Stream electrospray source. Data processing utilized Agilent OpenLAB CDS ChemStation with 2D-LC software and the 2D Chromatogram Creator in MassHunter.

Main results and discussion


Chlorodifluorobenzoic acid isomers:
The method resolved a low-level isomer (5-chloro-2,4-difluorobenzoic acid) hidden under a dominant isomer (3-chloro-2,4-difluorobenzoic acid). Using conventional DAD, signal-to-noise ratios for the trace isomer at 0.05% relative concentration were near the limit of quantification, yielding accuracy of 71.6% and RSD up to 7.95%. Employing the HDR-DAD solution to increase injection volume improved quantitation: S/N ratios rose above LOQ, RSDs fell below 1.6%, and accuracy reached 96.4–108.5%.

Deamidated insulin:
Time-based HiRes sampling isolated the tailing region of the intact insulin peak into ten cuts. Sequential 2D-LC/MS analysis generated total ion chromatograms for each cut, revealing a deamidation product coeluting in the 1D separation. Mass spectra extracted from the relevant cuts confirmed the presence of a +0.98 Da mass shift consistent with one deamidation event, demonstrating the ability to detect and identify low-level biopharmaceutical variants.

Benefits and practical applications


  • Enhanced selectivity: HiRes 2D-LC uncovers coeluting impurities hidden under dominant peaks.
  • Regulatory compliance: Achieves detection at ICH reporting thresholds (0.05% relative to API).
  • Quantitative reliability: HDR-DAD extends dynamic range to quantify high- and low-level analytes in a single run.
  • MS compatibility: Salt exclusion via diverter valve protects the ion source and enables structural confirmation of trace species.

Future trends and possibilities


The integration of advanced detectors (e.g., high-resolution MS, ion mobility) with HiRes sampling workflows will further improve impurity profiling. Automation of cut optimization, real-time data evaluation using AI-driven algorithms, and miniaturized 2D-LC systems could accelerate method development and routine monitoring in pharmaceutical and biopharmaceutical environments.

Conclusion


High-resolution sampling 2D-LC is a powerful approach for detecting and quantifying trace impurities that coelute with APIs in complex matrices. By segmenting the main peak into narrow fractions and applying fast second-dimension separations with high-dynamic-range detection or MS confirmation, this technique meets stringent quality control requirements and enhances confidence in impurity characterization.

References


  1. Venkatramani C. J.; et al. Assessing Stability-Indicating Methods for Coelution by Two-Dimensional Liquid Chromatography with Mass Spectrometric Detection. J. Sep. Sci. 2014, 37, 3214–3225.
  2. International Conference on Harmonization Q3A(R2): Impurities in New Drug Substances, 2006.
  3. Petersson P.; Haselmann K.; Buckenmaier S. Multiple Heart-Cutting Two-Dimensional Liquid Chromatography Mass Spectrometry: Towards Real-Time Determination of Related Impurities of Bio-Pharmaceuticals in Salt Based Separation Methods. J. Chromatogr. A 2016, 1468, 95–101.
  4. Stephan S. High-Resolution Sampling 2D-LC with the Agilent 1290 Infinity II 2D-LC Solution. Agilent Technologies Technical Overview, 2016.
  5. Schneider S. 2D-LC/MS Characterization of Charge Variants Using Ion Exchange and Reversed-Phase Chromatography Multiple Heart-Cutting 2D-LC Analysis of Innovator versus Biosimilar Monoclonal Antibodies. Agilent Technologies Application Note, 2016.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Analysis of Peptide/Protein*-Related Impurities Using the Integrated Solution of Bio 2D-LC/Q-TOF in Agilent MassHunter Software
Technical Overview Analysis of Peptide/Protein*-Related Impurities Using the Integrated Solution of Bio 2D-LC/Q-TOF in Agilent MassHunter Software Response units (%) ×102 1 0 D 2 16 17 18 1 D Acquisition time (min) 2.0 2.4 2.8 2 D Acquisition time…
Key words
mhc, mhctime, timeacquisition, acquisitioncuts, cutsunits, unitsmasshunter, masshunterdeck, deckhires, hiresmin, minshifted, shiftedpeptide, peptidegradient, gradientpeak, peakresponse, responsebased
Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities
Application Note Biopharma/Pharma Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities Using an Agilent 1290 Infinity III bio 2D-LC and an Agilent 6545XT AdvanceBio LC/Q-TOF Authors Abstract Paramjeet Khandpur, Preeti Bharatiya, and Ashish Pargaonkar Agilent Technologies, Inc.…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgimpurities, impuritiespeptide, peptideaegtftsdvssylegqaakefiawlvrgrg, aegtftsdvssylegqaakefiawlvrgrgsequence, sequenceimpurity, impurityadvancebio, advancebiomass, massacquisition, acquisitionmodifications, modificationstruncated, truncatedpeptides, peptidesmhc, mhcseparation
Simultaneous Impurity Analysis and Enantioseparation of Atenolol Using Achiral-Chiral 2D-LC
Application Note Pharma & Biopharma Simultaneous Impurity Analysis and Enantioseparation of Atenolol Using Achiral-Chiral 2D-LC Author Lucas Willmann Agilent Technologies, Inc. Abstract To ensure the quality of drug products, chromatographic separation of synthetic byproducts from active pharmaceutical ingredients (APIs), as…
Key words
atenolol, atenololimpurity, impuritychiral, chiralseparation, separationchromatographic, chromatographicenantioseparation, enantioseparationcut, cutphase, phasemhc, mhcimpurities, impuritieshypotensive, hypotensiveenantiomeric, enantiomericreversed, reversedopenlab, openlabcds
Clone Selection Using the Agilent 1290 Infinity Online 2D-LC/MS Solution
Clone Selection Using the Agilent 1290 Infinity Online 2D-LC/MS Solution Application Note Biopharmaceuticals Authors Abstract Ravindra Gudihal and This Application Note describes the Agilent 1290 Infinity online 2D-LC/MS Syed Salman Lateef solution and proof of principle for clone selection and…
Key words
counts, countsbiosimilar, biosimilarclone, clonedeconvoluted, deconvolutedamu, amumass, massinnovator, innovatoragilent, agilentcharge, chargepurification, purificationdesalting, desaltingrituximab, rituximabmin, minprotein, proteinmab
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike