LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Separation of Trypsin Digested Monoclonal Antibod

Applications | 2022 | ShimadzuInstrumentation
Consumables, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC columns
Industries
Pharma & Biopharma
Manufacturer
Shimadzu

Summary

Significance of the Topic


Peptide mapping using liquid chromatography–mass spectrometry (LC-MS) is essential for detailed characterization of monoclonal antibodies (mAbs). It enables identification of sequence variants, post-translational modifications and confirmation of glycosylation patterns. High-resolution separation and accurate mass detection are critical for ensuring product quality and comparability in biopharmaceutical development.

Objectives and Study Overview


This study demonstrates the separation performance of a Shim-pack Arata Peptide C18 column in combination with a Nexera X2 UHPLC system and LCMS-9030 mass spectrometer. The aim is to achieve comprehensive peptide coverage of trypsin-digested NIST mAb Reference Material 8671 and to evaluate chromatographic resolution, reproducibility and sensitivity.

Methodology and Used Instrumentation


UHPLC Conditions:
  • Column: Shim-pack Arata Peptide C18, 100 × 2.0 mm, 2.2 µm particle size
  • Column temperature: 50 °C
  • Mobile phases: A—0.1% formic acid in water; B—0.1% formic acid in acetonitrile
  • Gradient: 1% B (0–0.5 min) to 60% B (112 min), 95% B (112.05–117 min), re-equilibration to 1% B (117.01–120 min)
  • Flow rate: 0.2 mL/min; Injection volume: 2 µL
Mass Spectrometry Conditions:
  • Instrument: Shimadzu LCMS-9030 with heated electrospray ionization (ESI) in positive mode
  • Interface voltage: 4.5 kV; DL temperature: 250 °C; Heat block: 400 °C; Interface temperature: 300 °C
  • Scan range: m/z 350–2000; Nebulizer gas: 2 L/min; Drying and heating gas: 10 L/min each

Main Results and Discussion


The total ion chromatogram (TIC) displayed well-resolved peptide peaks across an 85-minute gradient. Key observations include:
  • High peak capacity enabling separation of closely eluting peptides derived from the heavy and light chains.
  • Consistent retention times across replicate injections, indicating robust column performance.
  • Sensitivity sufficient to detect low-abundance peptides and potential modifications.
The combination of a shallow gradient and optimized temperature control contributed to enhanced resolution of hydrophobic peptides.

Benefits and Practical Applications


This peptide mapping workflow offers several advantages:
  • Comprehensive sequence coverage for identity confirmation and variant detection.
  • Reproducible performance for lot-to-lot comparison in quality control.
  • Scalability for high-throughput environments due to stable baseline and column longevity.
Applications include biosimilar development, stability studies and in-process monitoring during mAb production.

Future Trends and Opportunities for Application


Advancements likely to impact peptide mapping include:
  • Faster gradients and sub-2 µm particle columns to reduce analysis time.
  • Integration of ion mobility spectrometry for enhanced separation of isobaric peptides.
  • Automated data processing pipelines and machine learning for PTM identification and quantitation.
  • Miniaturized and microflow LC-MS setups to decrease solvent consumption and improve sensitivity.

Conclusion


The described LC-MS method using Shim-pack Arata Peptide C18 and Nexera X2/LCMS-9030 provides high-resolution, reproducible peptide mapping of trypsin-digested monoclonal antibodies. It supports critical quality attributes assessment and can be adapted for advanced biopharmaceutical applications.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Separation of Trypsin Digested Monoclonal Antibody
ERAS-1000-0301 LC-MS Shim-pack Series Reversed phase Shim-pack™ GISS Separation of Trypsin Digested Monoclonal Antibody 301 Keywords: mAb, Peptide mapping, NIST monoclonal antibody reference material 8671 (x10,000,000) 1.5 1:TIC(+) 1.0 0.5 0.0 0 5 10 15 20 25 30 35 40…
Key words
trypsin, trypsindigested, digestedshim, shimpack, packgiss, gissflow, flowscan, scangas, gasmab, mabmonoclonal, monoclonalnist, nistphase, phaserinse, rinseantibody, antibodyheated
A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF
Peptide Mapping Analysis of Monoclonal Antibody / LCMS-9030 Application News A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF Shannie Tay1, Max Kosok1, Yu Jie Lee2 Shimadzu Asia Pacific, Singapore 2 National…
Key words
gfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflyskmetrics, metricspeptide, peptideprotein, proteinmabs, mabsptm, ptmmodifications, modificationsstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqty, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyamino, aminoicnvnhkpsntk, icnvnhkpsntkxics, xicsmodified, modifiedvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskepqvytlppsreemtknqvsltclvk
Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach
Liquid Chromatograph Mass Spectrometer LCMS™-9030 Application News Characterization of control and stress induced samples of trastuzumab biosimilar using LCMS-9030 by bottom-up approach Amita Puranik 1 , Deepti Bhandarkar 2, Prajakta Dandekar 3 , Pratap Rasam 2 , Tian hua Wang…
Key words
peptide, peptideunmodified, unmodifiedinduced, inducedstress, stressdeamidation, deamidationoxidation, oxidationptms, ptmsmodifications, modificationssusceptible, susceptiblemodified, modifiedcontrol, controlmodification, modificationmapping, mappingmab, mabnews
Shim-pack Arata LC column
Shim-pack Arata LC column
2023|Shimadzu|Brochures and specifications
C190-E238A Shim-pack Arata LC column Unprecedented Resolution and Peak Shape of Basic Compounds Even for LC columns that claim to be designed for basic compounds, adequate resolution often can not be obtained due to problems such as leading of highly…
Key words
arata, aratashim, shimpack, packmin, minsymmetry, symmetryods, odscolumn, columnequilibration, equilibrationbasic, basicshape, shapeacidic, acidicpeptides, peptidesfactor, factordrug, drugangiotensin
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike