Separation of Trypsin Digested Monoclonal Antibody

Applications | 2022 | ShimadzuInstrumentation
Consumables, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC columns
Industries
Pharma & Biopharma
Manufacturer
Shimadzu

Summary

Importance of the Topic


The detailed characterization of monoclonal antibodies by peptide mapping is critical for biopharmaceutical quality control and stability studies. High-resolution separation and accurate mass detection of tryptic digests enable verification of sequence integrity, post-translational modifications, and batch consistency. This approach supports regulatory compliance and ensures therapeutic safety and efficacy.

Objectives and Study Overview


This application note describes the separation and mass spectrometric analysis of trypsin-digested monoclonal antibody reference material (NIST RM 8671). The primary objectives are to demonstrate chromatographic performance of the Shim-pack GISS C18 column and to evaluate the LC-MS method for comprehensive peptide mapping of a complex biopolymer.

Methodology and Instrumentation


The peptide mapping workflow combines reversed-phase ultra-high-performance liquid chromatography (UHPLC) with high-resolution mass spectrometry. Key methodological features include:
  • Sample preparation: Trypsin digestion of NIST monoclonal antibody reference material.
  • Chromatography: Shim-pack GISS C18 column (150 × 2.1 mm, 1.9 µm) operated at 50 °C with a gradient from 1 % to 60 % acetonitrile over 112 minutes at 0.2 mL/min.
  • Mass spectrometry: LCMS-9030 equipped with heated electrospray ionization in positive mode, scanning m/z 350–2000.

Results and Discussion


The total ion chromatogram shows baseline separation of over 50 tryptic peptides with sharp, symmetric peaks spanning a 0–70 minute retention window. High-resolution MS data confirm accurate mass assignments and enable detection of minor modifications such as deamidation and oxidation. Consistent retention times and signal intensities demonstrate column reproducibility and method robustness.

Benefits and Practical Applications


The described LC-MS setup offers:
  • Comprehensive sequence coverage for monoclonal antibody mapping.
  • High sensitivity for low-abundance variant detection.
  • Reproducible chromatography suitable for routine QC laboratories.
  • Flexibility to adapt gradient programs for different biopharmaceutical molecules.

Future Trends and Opportunities


Advances in peptide mapping may include faster gradient capabilities, integration of ion mobility separation, automated data processing pipelines, and targeted MS/MS workflows for in-depth characterization of glycoforms and other modifications. Combining these innovations will further streamline biopharmaceutical analysis and accelerate product development.

Conclusion


The Shim-pack GISS C18 column paired with the LCMS-9030 system delivers high-resolution, reproducible peptide mapping of monoclonal antibodies. This method supports rigorous quality control, enabling reliable detection of sequence variants and post-translational modifications in complex biotherapeutic samples.

Used Instrumentation


  • UHPLC: Nexera X2 system with Shim-pack GISS C18 (150 × 2.1 mm, 1.9 µm).
  • Mobile phases: 0.1 % formic acid in water (A) and 0.1 % formic acid in acetonitrile (B).
  • Gradient: 1 % B (0–0.5 min) → 60 % B (0.5–112 min) → 95 % B (112.05–117 min) → 1 % B (117.01–120 min).
  • Flow rate: 0.2 mL/min; column oven: 50 °C; injection: 1 µL.
  • Mass spectrometer: Shimadzu LCMS-9030, heated ESI positive mode, DL 250 °C, interface 300 °C, heat block 400 °C, voltage 4.5 kV, scan range m/z 350–2000.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Separation of Trypsin Digested Monoclonal Antibod
ERAS-1000-0302 LC-MS Shim-packTM Series Reversed phase Shim-pack Arata™ Separation of Trypsin Digested Monoclonal Antibody 302 Keywords:mAb, Peptide mapping, NIST monoclonal antibody reference material 8671 (x10,000,000) 1:TIC(+) 1.5 1.0 0.5 0.0 0 5 10 15 20 25 30 35 40 45…
Key words
trypsin, trypsindigested, digestedshim, shimarata, arataflow, flowgas, gasscan, scanpacktm, packtmnist, nistmab, mabmonoclonal, monoclonalphase, phasepack, packrinse, rinseantibody
A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF
Peptide Mapping Analysis of Monoclonal Antibody / LCMS-9030 Application News A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF Shannie Tay1, Max Kosok1, Yu Jie Lee2 Shimadzu Asia Pacific, Singapore 2 National…
Key words
gfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflyskgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykmetrics, metricspeptide, peptideprotein, proteinmabs, mabsptm, ptmmodifications, modificationsstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqty, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyamino, aminoicnvnhkpsntk, icnvnhkpsntkxics, xicsmodified, modifiedvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskepqvytlppsreemtknqvsltclvk
Peptide Mapping of Monoclonal Antibody (mAb) Using LCMS-9030 (Q-TOF) Mass Spectrometerwith a Shim-pack GISS-HP Column
Application News No. AD-0212B Biopharma / LCMS-9030 (Q-TOF) Peptide Mapping of Monoclonal Antibody (mAb) Using LCMSTM-9030 (Q-TOF) Mass Spectrometer with a Shim-packTM GISS-HP Column Yonghai Lu and Zhaoqi Zhan Application Development & Support Centre, Shimadzu (Asia Pacific), Singapore ❑ Introduction…
Key words
peptide, peptidemab, mabnews, newschain, chainmarketing, marketingmin, minadduct, adductshimadzu, shimadzuatsuhiko, atsuhikomonoclonal, monoclonaltoyama, toyamamapping, mappingyonghai, yonghaiantibody, antibodybio
Pre-clinical estimation of cetuximab using nano-surface and molecular orientation limited (nSMOL) proteolysis and LC-MS/MS
TP 595 Pre-clinical estimation of cetuximab using nano-surface and molecular orientation limited (nSMOL) proteolysis and LC-MS/MS Deepti Bhandarkar, Rashi Kochhar, Shailendra Rane, Shailesh Damale, Purushottam Sutar, Anant Lohar, Ashutosh Shelar, Navin Devadiga, Bhaumik Trivedi, Ajit Datar, Pratap Rasam and Jitendra…
Key words
nsmol, nsmolcetuximab, cetuximabproteolysis, proteolysiswistar, wistarfab, fabcup, cuprat, ratspecificity, specificityantibody, antibodyregion, regionpeptides, peptidesselective, selectivegpsvfplapssk, gpsvfplapsskfilter, filterplasma
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike