Identification of Oxidation Sites on a Monoclonal Antibody Using an Agilent 1260 Infinity HPLC-Chip/MS System Coupled to an Accurate-Mass 6520 Q-TOF LC/MS
Applications | 2011 | Agilent TechnologiesInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordsmab, oxidized, oxidation, ntlylq, sslr, peptide, trypsin, monoclonal, mass, theoretical, antibody, bioconfirm, msslr, ntlylqmsslr, sequence, masshunter, agilent, peroxide, oxidative, modification, sites, dioxidation, dnskntlylqmsslr, glewvsaisgsggstyyadsvk, lqmsslr, ntl, qmsslr, rfvsgafdiwgqgtmvtvssastkgpsvfplapssk, ylqmsslr, peptides, vyacevthqglsspvtksfnr, using, were, digest, oxidatively, srwqqgnvfscsvmhealhnhytqk, characterization, vqwkvdnalqsgnsqesvteqdsk, hkvyacevthqglsspvtk, protein, obtained, molecular, hydrogen, ppm, gfypsdiavewesngqpennyk, preferred, analyzed, mfe, occur, digestion
Similar PDF
Quantitation of Oxidation Sites on a Monoclonal Antibody Using an Agilent 1260 Infinity HPLC-Chip/MS System Coupled to an Accurate-Mass 6520 Q-TOF LC/MS
2011|Agilent Technologies|Applications
Quantitation of Oxidation Sites on a Monoclonal Antibody Using an Agilent 1260 Infinity HPLC-Chip/MS System Coupled to an Accurate-Mass 6520 Q-TOF LC/MS Application Note Authors Abstract Ravindra Gudihal Agilent Technologies India Pvt. Ltd. Bangalore, India The identification of oxidation sites…
Key words
oxidation, oxidationpeptide, peptideoxidized, oxidizedbhp, bhpmab, mabmet, metmethionine, methioninetrypsin, trypsinsites, sitesantibody, antibodybioconfirm, bioconfirmwere, weremonoclonal, monoclonalmasshunter, masshunteragilent
Peptide Mapping of Innovator and Biosimilar Monoclonal Antibody Using an Agilent 1290 Infinity UHPLC Coupled to an Agilent 6550 iFunnel Q-TOF LC/MS System
2017|Agilent Technologies|Applications
Peptide Mapping of Innovator and Biosimilar Monoclonal Antibody Using an Agilent 1290 Infinity UHPLC Coupled to an Agilent 6550 iFunnel Q-TOF LC/MS System Application Note Author Introduction Ravindra Gudihal Monoclonal antibodies (mAbs) are becoming one of the important classes of…
Key words
peptide, peptideinnovator, innovatorbiosimilar, biosimilardeamidation, deamidationcounts, countsoxidation, oxidationdltmisr, dltmisrmapping, mappingtrypsin, trypsinunmodified, unmodifiedoxi, oxiions, ionsheight, heightcharge, chargegfypsdiavewesngqpennyk
LC/MS/MS Peptide Mapping Comparison of Innovator and Biosimilars of Rituximab
2019|Agilent Technologies|Applications
Application Note Biotherapeutics and Biosimilars LC/MS/MS Peptide Mapping Comparison of Innovator and Biosimilars of Rituximab Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract The development and manufacturing of biosimilars require comparability studies with innovator biotherapeutic products. This Application Note presents…
Key words
innovator, innovatorpeptide, peptidecounts, countschain, chainmapping, mappingbiosimilar, biosimilarcharge, chargeunmodified, unmodifiedptms, ptmsheavy, heavyassaymap, assaymapttppvldsdgsfflyskl, ttppvldsdgsfflysklbravo, bravomabs, mabsbiosimilars
Enhancing The Quality Of Peptide Mapping Separation For The Analysis Of PTM
2017|Agilent Technologies|Applications
Enhancing The Quality Of Peptide Mapping Separation For The Analysis Of PTM Application Note Biotherapeutics and Biosimilars Author Introduction Suresh Babu C.V. Post-translational modifications (PTMs) on proteins such as monoclonal antibodies (mAbs) are critical quality attributes (CQAs) that define the…
Key words
peptide, peptidecounts, countsntaylqmnslr, ntaylqmnslradvancebio, advancebiodltmisr, dltmisrmab, mabeeeqynstr, eeeqynstrptms, ptmsdeamidated, deamidatedplus, plusdigest, digestmapping, mappingseparation, separationnonoxidized, nonoxidizedtryptic