Development of a multiplex ultra-sensitive LC-MS method for the quantification of Alzheimer's disease main blood biomarkers (pTau,Tau, APOE, Aβ, 𝜶-synuclein) : a challenge
Posters | 2023 | Shimadzu | ASMSInstrumentation
Sample Preparation, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC columns, LC/QQQ
IndustriesClinical Research
ManufacturerAgilent Technologies, Shimadzu, Bruker, Evosep
Key wordsdetected, alzheimer, immunocapture, capture, antibody, tau, phosphorylation, phosphorylated, targeting, development, ptau, project, disease, sites, synuclein, specific, microtubule, apolipoprotein, peptide, csf, gathered, hospital, multiplex, progression, performances, part, correlated, collaboration, pooled, biomarkers, preliminary, performed, method, alpha, antibodies, detecting, university, innovative, national, enabling, clinical, dedicated, detection, preparation, center, peptides, stored, corresponding, allowed, charge
Similar PDF
A multiplex targeted Mass spectrometry approach for the quantification of synuclein proteoforms in human biological fluids
2020|Shimadzu|Posters
TP 535 A multiplex targeted Mass spectrometry approach for the quantification of synuclein proteoforms in human biological fluids 1, 2 1 2 1 1 Pons ML , Vialaret J , Moreau S , Lehmann S and Hirtz C 1 IRMB,…
Key words
synuclein, synucleinproteotypic, proteotypicpeptide, peptidealpha, alphaimmunocapture, immunocapturecsf, csfhemoglobin, hemoglobinmultiplex, multiplextargeted, targetedagsiaaatgfvkkdqlgkneegapqegiledmpvdpdneayemp, agsiaaatgfvkkdqlgkneegapqegiledmpvdpdneayempanytical, anyticalegvlyvgsk, egvlyvgskegvvaaaek, egvvaaaekegvvgavek, egvvgavekegvvhgvatvaek
NINTH ANNUAL CONFERENCE OF THE CZECH SOCIETY FOR MASS SPECTROMETRY Prague, October 11 – October 12, 2021 BOOK OF ABSTRACTS Book of Abstracts from the Ninth Annual Conference of the Czech Society for Mass Spectrometry Czech Society for Mass Spectrometry…
Key words
conference, conferenceprogram, programspectrometry, spectrometrysiderophores, siderophoresinvasive, invasivemass, massczech, czechbrain, brainaspergillosis, aspergillosisprotein, proteinrepublic, republicninth, ninthorganoids, organoidscomplexes, complexessociety
Multimodal Chemical Imaging to probe Alzheimer’s Disease Pathology
2020|Bruker|Applications
Multimodal Chemical Imaging to probe Alzheimer’s Disease Pathology MALDI Imaging has emerged as a valuable tool for understanding neurodegenerative pathology in Alzheimer’s disease. Abstract Already affecting 12% of population over the age of 65, and with an exponential increase in…
Key words
amyloid, amyloidplaque, plaqueimaging, imagingplaques, plaquespathology, pathologysad, sadmaldi, maldidiffuse, diffuselco, lcopolymorphism, polymorphismdisease, diseaseneurodegenerative, neurodegenerativemultimodal, multimodalmajor, majoralzheimer
Multimodal Chemical Imaging to probe Alzheimer’s Disease Pathology
2020|Bruker|Applications
Multimodal Chemical Imaging to probe Alzheimer’s Disease Pathology MALDI Imaging has emerged as a valuable tool for understanding neurodegenerative pathology in Alzheimer’s disease. Abstract Already affecting 12% of population over the age of 65, and with an exponential increase in…
Key words
amyloid, amyloidplaque, plaqueimaging, imagingplaques, plaquespathology, pathologysad, sadmaldi, maldidiffuse, diffuselco, lcopolymorphism, polymorphismdisease, diseaseneurodegenerative, neurodegenerativemultimodal, multimodalalzheimer, alzheimermajor