A multiplex targeted Mass spectrometry approach for the quantification of synuclein proteoforms in human biological fluids
Posters | 2020 | ShimadzuInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesProteomics
ManufacturerShimadzu
Key wordssynuclein, proteotypic, peptide, alpha, immunocapture, csf, hemoglobin, multiplex, targeted, agsiaaatgfvkkdqlgkneegapqegiledmpvdpdneayemp, anytical, egvlyvgsk, egvvaaaek, egvvgavek, egvvhgvatvaek, egvvqgvasvaek, envvqsvtsvaek, eqanavseavvssvntvatk, eqashlggavfsgagniaaatglvk, eqvtnvggavvtgvtavaqk, kenvvqsvtsvaektkeqanavseavvssvntvatktveeaeniav, mdvfkkgfsiakegvvgavektkqgvteaaektkegvmyvgakt, mdvfmk, mdvfmkglskakegvvaaaektkqgvaeaagktkegvlyvg, mdvfmkglsmakegvvaaaektkqgvteaaektkegvlyvgskt, ptdlkpeevaqeaaeeplieplmepegesyedppqeeyqeyepea, qgvaeaagk, qgvteaaek, regvvqgvasvaektkeqashlggavfsgagniaaatglvkreef, seegyqdyepea, sktkegvvhgvatvaektkeqvtnvggavvtgvtavaqktveg, synculein, tsgvvrkedlrpsapqqegeaskekeevaeeaqsggd, tveeaeniavtsgvvr, tvegagsiaaatgfvk, tyfphfdlshgsaqvk, mrm, beta, intensively, biological, mikros, sequence, ter, proteoforms, approach, brain, developed, aggregates, fluids, gamma
Similar PDF
Development of a multiplex ultra-sensitive LC-MS method for the quantification of Alzheimer's disease main blood biomarkers (pTau,Tau, APOE, Aβ, 𝜶-synuclein) : a challenge
2023|Agilent Technologies|Posters
WP-053 Development of a multiplex ultra-sensitive LC-MS method for the quantification of Alzheimer's disease main blood biomarkers (pTau,Tau, APOE, Aβ, 𝜶-synuclein) : a challenge Florine Leipp1,2, Jérôme Vialaret2, Doriane Toinon3, Ann-Christin Niehoff4, Sylvain Lehmann2 and Christophe Hirtz2 1. Shimadzu France…
Key words
detected, detectedalzheimer, alzheimerimmunocapture, immunocapturecapture, captureantibody, antibodytau, tauphosphorylation, phosphorylationphosphorylated, phosphorylatedtargeting, targetingdevelopment, developmentptau, ptauproject, projectdisease, diseasesites, sitessynuclein
Quantification of Host Cell Protein Impurities Using the Agilent 1290 Infinity II LC Coupled with the 6495B Triple Quadrupole LC/MS System
2018|Agilent Technologies|Applications
Application Note Biotherapeutics Quantification of Host Cell Protein Impurities Using the Agilent 1290 Infinity II LC Coupled with the 6495B Triple Quadrupole LC/MS System Authors Linfeng Wu and Yanan Yang Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Host Cell…
Key words
protein, proteinsil, silpeptide, peptideskyline, skylinecounts, countstargeted, targetedamol, amolassaymap, assaymaphcp, hcppeptides, peptidesquantification, quantificationdpgvldr, dpgvldrllleyleek, llleyleekvfdviir, vfdviirbravo
A Semi Quantitative Method for the Analysis of Tryptic Peptides in Human Serum: A Rapid, Targeted UPLC-MS/MS Approach Using Biognosys Plasma Dive Kit
2018|Waters|Applications
[ APPLICATION NOTE ] A Semi Quantitative Method for the Analysis of Tryptic Peptides in Human Serum: A Rapid, Targeted UPLC-MS/MS Approach Using Biognosys Plasma Dive Kit Billy Joe Molloy Waters Corporation, Wilmslow, UK APPLICATION BENEFITS ■■ ■■ Targeted, semi-quantitative…
Key words
apolipoprotein, apolipoproteinfactor, factorcoagulation, coagulationkallikrein, kallikreinkallistatin, kallistatinchain, chainbinding, bindinguplc, uplcinhibitor, inhibitorsubunit, subunitxiii, xiiifibrinogen, fibrinogenhaptoglobin, haptoglobinproteins, proteinsglobulin
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinprotein, proteinuplc, uplcpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing