Peptide Mapping of Trastuzumab Tryptic Digests on an Agilent 6545XT AdvanceBio LC/Q-TOF
Applications | 2024 | Agilent TechnologiesInstrumentation
Peptide mapping by LC-MS/MS is essential for verifying monoclonal antibody primary sequence and for precise localization of PTMs such as deamidation and glycosylation in biopharmaceutical development and quality control. Its ability to combine MS1 and MS2 data ensures comprehensive molecular characterization of therapeutic proteins, supporting their efficacy, safety and regulatory compliance.
The study aimed to establish a robust peptide mapping workflow for tryptic digests of trastuzumab using an Agilent 6545XT AdvanceBio LC/Q-TOF. Key goals included achieving high sequence coverage across replicates, demonstrating dynamic range for low-abundance peptides, and confidently identifying PTM sites including deamidation and glycoforms.
Trastuzumab samples underwent reduction, alkylation and overnight digestion with Trypsin/LysC at a 25:1 protein-to-enzyme ratio in 1 M guanidine HCl buffer. No desalting was applied prior to LC/MS analysis. Chromatographic separation used an Agilent 1290 Infinity II Bio LC system with an AdvanceBio Peptide Mapping column (2.1 × 150 mm, 2.7 μm). The 6545XT AdvanceBio LC/Q-TOF was configured with dual Jet Stream ESI, optimized at a fragmentor voltage of 95 V to balance ion transmission and minimize in-source fragmentation. MS1 and data-dependent MS/MS were acquired at 3 spectra/s, covering m/z 200–3000 and 100–3000, respectively. Data processing employed Agilent MassHunter BioConfirm 12.1 with stringent filters (5 ppm MS1, 20 ppm MS2, BioScore ≥ 5).
Sequence coverage for trastuzumab reached 98–99.7% across three replicates, with the only missing segment at the glycan site N300. Trypsin autolysis peptides accounted for ~54% coverage, highlighting the importance of monitoring enzyme fragments. Representative low-abundance peptides with MS1 signals near 1 × 10^4 exhibited complete fragment ladders, demonstrating extended dynamic range. Deamidation of peptide FTISADTSKNTAYLQMNSLR was unambiguously localized at Asn17 through characteristic b- and y-ion shifts. Glycopeptide mapping of TKPREEQYNSTYR revealed multiple glycoforms (G0, G0F, G1F, etc.) with MS1 intensities in the 10^5 range and confirmed peptide backbone fragments at m/z values above 1500 in MS/MS despite dominant glycan fragmentation.
Anticipated advances include automation of sample preparation, integration of ion mobility for additional separation of isobaric PTMs, AI-driven spectral analysis to streamline data interpretation, and expansion of multiplexed workflows for simultaneous characterization of multiple biotherapeutics. Enhanced column chemistries and ultra-high-resolution mass analysis may further improve glycoform and PTM profiling depth.
The described peptide mapping approach on an Agilent 6545XT AdvanceBio LC/Q-TOF delivers high sequence coverage, dynamic range for low-abundance peptides, and reliable PTM localization. This workflow offers a comprehensive solution for monoclonal antibody characterization in research and regulated environments.
LC/HRMS, LC/MS, LC/MS/MS, LC/TOF
IndustriesProteomics , Pharma & Biopharma
ManufacturerAgilent Technologies
Summary
Importance of the Topic
Peptide mapping by LC-MS/MS is essential for verifying monoclonal antibody primary sequence and for precise localization of PTMs such as deamidation and glycosylation in biopharmaceutical development and quality control. Its ability to combine MS1 and MS2 data ensures comprehensive molecular characterization of therapeutic proteins, supporting their efficacy, safety and regulatory compliance.
Objectives and Study Overview
The study aimed to establish a robust peptide mapping workflow for tryptic digests of trastuzumab using an Agilent 6545XT AdvanceBio LC/Q-TOF. Key goals included achieving high sequence coverage across replicates, demonstrating dynamic range for low-abundance peptides, and confidently identifying PTM sites including deamidation and glycoforms.
Methodology
Trastuzumab samples underwent reduction, alkylation and overnight digestion with Trypsin/LysC at a 25:1 protein-to-enzyme ratio in 1 M guanidine HCl buffer. No desalting was applied prior to LC/MS analysis. Chromatographic separation used an Agilent 1290 Infinity II Bio LC system with an AdvanceBio Peptide Mapping column (2.1 × 150 mm, 2.7 μm). The 6545XT AdvanceBio LC/Q-TOF was configured with dual Jet Stream ESI, optimized at a fragmentor voltage of 95 V to balance ion transmission and minimize in-source fragmentation. MS1 and data-dependent MS/MS were acquired at 3 spectra/s, covering m/z 200–3000 and 100–3000, respectively. Data processing employed Agilent MassHunter BioConfirm 12.1 with stringent filters (5 ppm MS1, 20 ppm MS2, BioScore ≥ 5).
Instrumentation Used
- Agilent 1290 Infinity II Bio LC system
- Agilent 6545XT AdvanceBio LC/Q-TOF with dual Jet Stream ESI
- AdvanceBio Peptide Mapping column, 2.1 × 150 mm, 2.7 μm
- MassHunter BioConfirm software, version 12.1
Main Results and Discussion
Sequence coverage for trastuzumab reached 98–99.7% across three replicates, with the only missing segment at the glycan site N300. Trypsin autolysis peptides accounted for ~54% coverage, highlighting the importance of monitoring enzyme fragments. Representative low-abundance peptides with MS1 signals near 1 × 10^4 exhibited complete fragment ladders, demonstrating extended dynamic range. Deamidation of peptide FTISADTSKNTAYLQMNSLR was unambiguously localized at Asn17 through characteristic b- and y-ion shifts. Glycopeptide mapping of TKPREEQYNSTYR revealed multiple glycoforms (G0, G0F, G1F, etc.) with MS1 intensities in the 10^5 range and confirmed peptide backbone fragments at m/z values above 1500 in MS/MS despite dominant glycan fragmentation.
Benefits and Practical Applications
- Confident confirmation of mAb primary structure with >98% coverage
- Precise localization of deamidation and other PTMs
- Robust glycoform profiling in a single workflow
- Sensitive detection of low-abundance peptides for quality control
Future Trends and Potential Applications
Anticipated advances include automation of sample preparation, integration of ion mobility for additional separation of isobaric PTMs, AI-driven spectral analysis to streamline data interpretation, and expansion of multiplexed workflows for simultaneous characterization of multiple biotherapeutics. Enhanced column chemistries and ultra-high-resolution mass analysis may further improve glycoform and PTM profiling depth.
Conclusion
The described peptide mapping approach on an Agilent 6545XT AdvanceBio LC/Q-TOF delivers high sequence coverage, dynamic range for low-abundance peptides, and reliable PTM localization. This workflow offers a comprehensive solution for monoclonal antibody characterization in research and regulated environments.
References
- Zheng K., Bantog C., Bayer R. The Impact of Glycosylation on Monoclonal Antibody Conformation and Stability. MAbs 2011, 3(6):568–576.
- Mouchahoir T., Schiel J.E. Development of an LC-MS/MS Peptide Mapping Protocol for the NISTmAb. Anal. Bioanal. Chem. 2018, 410(8):2111–2126.
- Kim S., Gupta N., Pevzner P.A. Spectral Probabilities and Generating Functions of Tandem Mass Spectra: A Strike Against Decoy Databases. J. Proteome Res. 2008, 7(8):3354–3363.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Enhancing The Quality Of Peptide Mapping Separation For The Analysis Of PTM
2017|Agilent Technologies|Applications
Enhancing The Quality Of Peptide Mapping Separation For The Analysis Of PTM Application Note Biotherapeutics and Biosimilars Author Introduction Suresh Babu C.V. Post-translational modifications (PTMs) on proteins such as monoclonal antibodies (mAbs) are critical quality attributes (CQAs) that define the…
Key words
peptide, peptidecounts, countsntaylqmnslr, ntaylqmnslradvancebio, advancebiodltmisr, dltmisrmab, mabeeeqynstr, eeeqynstrptms, ptmsdeamidated, deamidatedplus, plusdigest, digestmapping, mappingseparation, separationnonoxidized, nonoxidizedtryptic
Glycopeptide Characterization for Various Monoclonal Antibodies Using the Agilent 6545XT AdvanceBio LC/Q-TOF
2019|Agilent Technologies|Applications
Application Note Biotherapeutics and Biosimilars Glycopeptide Characterization for Various Monoclonal Antibodies Using the Agilent 6545XT AdvanceBio LC/Q-TOF Author David L. Wong Agilent Technologies, Inc. Introduction Monoclonal antibodies (mAbs) and their derivatives represent a very complex but important class of biopharmaceutical…
Key words
glycopeptides, glycopeptidesglycan, glycanmapping, mappingglycopeptide, glycopeptidemab, mabadvancebio, advancebiopeptide, peptideassaymap, assaymaptkpreeqynstyr, tkpreeqynstyrbravo, bravohilic, hilicpeptides, peptideswere, weremabs, mabscolumn
Peptide Mapping of Tryptic Digests for mAbs using a novel ECD cell on the 6545XT AdvanceBio LC/Q-TOF Mass Spectrometer
2024|Agilent Technologies|Posters
Poster Reprint ASMS 2024 Poster number MP 665 Peptide Mapping of Tryptic Digests for mAbs using a novel ECD cell on the 6545XT AdvanceBio LC/Q-TOF Mass Spectrometer Stephen Sciuto1, Maozi Liu1, Rachel Franklin2, Jerry Han1 1Agilent Technologies, Inc., Santa Clara,…
Key words
tryptic, trypticglycopeptide, glycopeptidetkpreeqynstyrvvsvltvlhqdwlngk, tkpreeqynstyrvvsvltvlhqdwlngkptms, ptmsdigests, digestsdissociation, dissociationexd, exdfragment, fragmenttrastuzumab, trastuzumabpeptide, peptidemabs, mabscid, cidsheath, sheathgas, gashexnac
In-depth Peptide Mapping with Iterative MS/MS Acquisition on the Agilent 6545XT AdvanceBio LC/Q‑TOF
2020|Agilent Technologies|Applications
Application Note Biotherapeutics and Biosimilars In-depth Peptide Mapping with Iterative MS/MS Acquisition on the Agilent 6545XT AdvanceBio LC/Q‑TOF Authors Introduction Linfeng Wu and David L. Wong Agilent Technologies, Inc. Santa Clara, CA, USA Therapeutic monoclonal antibodies (mAbs) represent one of…
Key words
ntaylqmnslr, ntaylqmnslriterative, iterativepeptide, peptidemapping, mappingcounts, countsauto, autoacquisition, acquisitionassaymap, assaymapcharge, chargeprecursors, precursorseccs, eccsmass, massbravo, bravoagilent, agilentisoasp