LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Structural Characterization of Multiple GLP-1 Receptor Agonists using Electron Capture Dissociation

Posters | 2025 | Agilent Technologies | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/TOF, LC/HRMS
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Importance of the topic


The prevalence of type 2 diabetes and obesity has driven rapid growth in the development of GLP-1 receptor agonists. Early and accurate structural characterization of these therapeutic peptides is essential to ensure sequence fidelity, confirm post-translational modifications, and accelerate candidate selection in drug discovery.

Objectives and study overview


This study applies liquid chromatography coupled with tandem mass spectrometry using electron capture dissociation (ECD) to achieve in-depth sequence mapping and modification localization of three GLP-1 receptor agonists: semaglutide, liraglutide, and tirzepatide. The goal was to demonstrate comprehensive characterization, including isomer detection and modification retention, using Agilent instrumentation and ExDViewer software.

Methodology and instrumentation


  • Sample preparation: Peptides at 10 μM in 15 % acetonitrile with 0.1 % formic acid; equimolar mixtures for LC analysis.
  • Liquid chromatography: Agilent 1290 Infinity II Bio LC System with AdvanceBio Peptide Mapping column.
  • Mass spectrometry: Agilent 6545XT AdvanceBio LC/Q-TOF equipped with ExD cell for ECD fragmentation; direct infusion for charge-state studies without internal calibration.
  • Data analysis: ExDViewer software for targeted deconvolution, custom amino-acid and modification definitions, and automated fragmentation annotation.

Main results and discussion


  • Intact mass determination: Monoisotopic masses measured as semaglutide 4 112.12 Da, liraglutide 3 749.95 Da, tirzepatide 4 811.53 Da, with isotopically resolved signals deconvoluted effectively by ExDViewer.
  • Charge-state optimization: The 4+ precursor yielded 100 % sequence coverage with optimal fragment intensity; 3+ ions required supplemental collision energy for improved fragmentation, while 5+ ions risked over-fragmentation.
  • Isoaspartate monitoring: ECD-specific c+57 and z–57 fragments facilitated detection of isoAsp in model peptides; analysis of liraglutide confirmed absence of isoAsp at Asp8 position.
  • Modification localization: ECD preserved fatty-acid and non-standard amino-acid modifications (e.g., 2-aminoisobutyrate and Lys20 acylation in semaglutide), enabling precise mapping without extensive CID tuning.

Benefits and practical applications


This workflow delivers robust structural confirmation for synthetic peptide therapeutics, supporting quality control, regulatory submissions, and accelerating lead optimization by providing high-confidence sequence and modification data early in development.

Future trends and potential applications


  • Integration with automated data processing and artificial intelligence for higher throughput and predictive fragmentation analysis.
  • Extension to larger biopharmaceuticals and antibody-drug conjugates to map complex post-translational modifications.
  • Combination with complementary fragmentation techniques (e.g., UVPD) to further enhance coverage and isomer discrimination.
  • Application in personalized medicine for rapid verification of peptide variants and analogs.

Conclusion


Electron capture dissociation coupled with high-resolution LC/Q-TOF MS and ExDViewer software provides a comprehensive platform for detailed sequence mapping, modification localization, and isomer detection of GLP-1 receptor agonists, meeting critical needs in peptide drug development.

Reference


  1. Comprehensive Characterization of Multiple GLP-1 Analogs Using an Agilent 6545XT AdvanceBio LC/Q-TOF with ECD and Agilent ExDViewer software. Agilent Technologies application note 5994-7994EN, 2025.
  2. Identification of Amino Acid Isomers Using Electron Capture Dissociation in the Agilent 6545XT AdvanceBio LC/Q-TOF System. Agilent Technologies application note 5994-7506EN, 2024.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Comprehensive Characterization of Multiple GLP-1 Analogs
Comprehensive Characterization of Multiple GLP-1 Analogs
2025|Agilent Technologies|Applications
Application Note Biopharma Comprehensive Characterization of Multiple GLP-1 Analogs Using an Agilent 6545XT AdvanceBio LC/Q-TOF with electron capture dissociation and ExDViewer software Authors Rachel Franklin, Mike Hare, Thomas Walker, and Joseph Meeuwsen Agilent Technologies, Inc. Abstract GLP-1 analogs are synthetic…
Key words
exdviewer, exdviewerfragmentation, fragmentationecd, ecdintensity, intensityexd, exdisod, isodsequence, sequenceamino, aminocid, ciddeconvolution, deconvolutionelectron, electronvisualizing, visualizingfragment, fragmentmodifications, modificationscharacterization
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeabundance, abundanceadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg
Streamlined Analysis of Synthetic Peptides with Non-Standard Amino Acid Chemistry
Poster Reprint ASMS 2025 Poster number TP 622 Streamlined Analysis of Synthetic Peptides with Non-Standard Amino Acid Chemistry Rachel Franklin , Adrian Guthals , Joseph C. Meeuwsen Agilent Technologies, Inc., Corvallis, OR Introduction Synthetic peptides with unique amino acid chemistry…
Key words
peptoid, peptoidpeptoids, peptoidsexdviewer, exdviewerstreamlined, streamlinedecd, ecdsynthetic, syntheticfragmentation, fragmentationfragment, fragmentrules, rulespeptides, peptidesbuilding, buildingchemistry, chemistrycid, cidanalysis, analysiscaliper
Workflow Solutions for Peptide Therapeutics - Application Compendium
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabimpurities, impuritiessemaglutide, semaglutidesynthetic, syntheticmsd, msdnotes, notestherapeutics
Other projects
GCMS
ICPMS
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike