Comprehensive Characterization of Multiple GLP-1 Analogs

Applications | 2025 | Agilent TechnologiesInstrumentation
Software, LC/HRMS, LC/MS, LC/MS/MS, LC/TOF
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the topic


Glucagon‐like peptide‐1 (GLP-1) analogs represent an important class of therapeutic peptides used in managing type 2 diabetes and obesity. These molecules feature custom modifications—such as fatty acid attachments and noncanonical amino acids—that impact their stability, pharmacokinetics, and efficacy. Accurate structural characterization of GLP-1 analogs is essential for quality control, impurity profiling, and counterfeit detection in biopharmaceutical development.

Objectives and study overview


This study aims to demonstrate a comprehensive workflow for sequence confirmation and modification mapping of three GLP-1 analogs—liraglutide, semaglutide, and tirzepatide—using an Agilent 6545XT AdvanceBio LC/Q-TOF mass spectrometer equipped with an ExD cell for electron capture dissociation (ECD). Agilent ExDViewer software is evaluated for its abilities in MS1 deconvolution, targeted MS/MS analysis, and data visualization to streamline peptide characterization.

Methodology and instrumentation


Sample preparation involved diluting each peptide to 10 µM in 15 % acetonitrile with 0.1 % formic acid, followed by mixing equal volumes. Liquid chromatography was performed on an Agilent 1290 Infinity II Bio LC system with an AdvanceBio Peptide Mapping column (2.1 × 150 mm, 2.7 µm) at 60 °C, using a water–acetonitrile gradient (0.1 % formic acid) at 0.4 mL/min. Mass spectrometry employed the Agilent 6545XT LC/Q-TOF with Dual Jet Stream ESI source and an ExD cell for ECD. Parameters included a 2 GHz acquisition range (m/z 120–3200), positive polarity, and optional supplemental collision energy for combined ECD/CID experiments. Data processing used Agilent MassHunter for acquisition and ExDViewer (v4.6.12) for MS1 deconvolution and targeted MS/MS fragment matching, with custom amino acids and modifications defined in the software’s editors.

Main results and discussion


  • MS1 deconvolution produced monoisotopic masses for each analog (e.g., semaglutide 4112.12 Da, liraglutide 3751.93 Da, tirzepatide 4837.50 Da), resolving minor salt adducts.
  • Electron capture dissociation yielded extensive backbone cleavage, delivering 100 % sequence coverage for the 4+ precursors of all peptides at 2 Hz.
  • Side chain fragmentation (w-ions) provided evidence for distinguishing isomeric residues such as aspartate vs. isoaspartate.
  • Combining ECD with 35 V supplemental collision energy improved sequence coverage of the less-charged (3+) semaglutide precursor from 57 % to 93 %, without a net loss in fragment ion abundance.
  • High-quality modification‐containing fragments (ion score ≥10) were more abundant in ECD spectra than in CID spectra, enhancing confidence in mapping fatty acid linkers on lysine residues.

Benefits and practical applications


  • ECD provides a gentle fragmentation approach that preserves labile modifications while delivering rich sequence information.
  • ExDViewer’s integrated deconvolution and targeted workflows simplify identification of nonstandard amino acids and custom modifications.
  • The combined hardware/software solution accelerates method development by minimizing collision energy optimization.
  • High sequence coverage and modification localization support robust quality control in peptide drug development and counter‐fraud analysis.

Future trends and potential applications


  • Extending this platform to novel GLP-1 derivative libraries and impurity screening.
  • Integration with ion mobility spectrometry for conformer-specific characterization.
  • Automation and AI‐driven spectral interpretation to further accelerate peptide analytics.
  • Application to other therapeutic peptides and small proteins with complex chemical modifications.

Conclusion


This study establishes a streamlined LC–MS/MS workflow combining ECD on an Agilent 6545XT LC/Q-TOF and ExDViewer software for in-depth structural characterization of GLP-1 analogs. The approach achieves complete sequence coverage, distinguishes isomeric residues, and pinpoints modification sites with high confidence, supporting advanced quality assessment in biopharmaceutical research.

References


1. Andersen A.; Lund A.; Knop F. K.; Vilsbøll T. Nat. Rev. Endocrinol. 2018, 14(7), 390–403.
2. Holst J. J. Physiol. Rev. 2007, 87(4), 1409–1439.
3. FDA News Release. Approval of First Oral GLP-1 Treatment for Type 2 Diabetes, 2019.
4. FDA News Release. Weight Management Drug Approval for Patients Aged 12 and Older, 2020.
5. Beckman J. S. et al. J. Am. Soc. Mass Spectrom. 2021, 32(8), 2081–2091.
6. Wang J.; Mukherjee S.; Zubarev R. A. Aging (Albany NY) 2022, 14(22), 8882.
7. Identification of Amino Acid Isomers Using ECD on Agilent 6545XT LC/Q-TOF. Agilent Technologies App Note, 2024.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Structural Characterization of Multiple GLP-1 Receptor Agonists using Electron Capture Dissociation
Poster Reprint ASMS 2025 Poster number WP 603 Structural Characterization of Multiple GLP-1 Receptor Agonists using Electron Capture Dissociation Rachel Franklin1; Julie Horner-Buxton2; Joseph C. Meeuwsen1; Thomas E. Walker3; Mike Hare1 1Agilent Technologies, Inc., Corvallis, OR; 2Agilent Technologies, Santa Clara,…
Key words
exdviewer, exdviewerfragmentation, fragmentationamino, aminoisoaspartate, isoaspartateecd, ecdmodification, modificationsequence, sequenceacids, acidsevidence, evidencedeconvolution, deconvolutionvisualizing, visualizingfragment, fragmentisomeric, isomericionscore, ionscoredissociation
Streamlined Analysis of Synthetic Peptides with Non-Standard Amino Acid Chemistry
Poster Reprint ASMS 2025 Poster number TP 622 Streamlined Analysis of Synthetic Peptides with Non-Standard Amino Acid Chemistry Rachel Franklin , Adrian Guthals , Joseph C. Meeuwsen Agilent Technologies, Inc., Corvallis, OR Introduction Synthetic peptides with unique amino acid chemistry…
Key words
peptoid, peptoidpeptoids, peptoidsexdviewer, exdviewerstreamlined, streamlinedecd, ecdsynthetic, syntheticfragmentation, fragmentationfragment, fragmentpeptides, peptidesrules, rulesbuilding, buildingchemistry, chemistrycid, cidanalysis, analysiscaliper
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Workflow Solutions for Peptide Therapeutics - Application Compendium
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabimpurities, impuritiessemaglutide, semaglutidesynthetic, syntheticmsd, msdtherapeutics, therapeuticsnotes
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike