LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Improving Sensitivity of GLP-1 Analogues Quantitation Using Multiple Spray ESI Technology on a Microflow LC-MS/MS

Posters | 2025 | Shimadzu | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Pharma & Biopharma
Manufacturer
Shimadzu

Summary

Importance of the Topic


Glucagon-like peptide-1 (GLP-1) receptor agonists are key biotherapeutics for type 2 diabetes and obesity management. Their large size poses ionization and carryover challenges in LC-MS/MS analysis.

Objectives and Study Overview


This study aims to enhance quantitation sensitivity for semaglutide and liraglutide by implementing multiple-spray electrospray ionization (ESI) technology on a microflow LC-MS/MS platform, comparing performance to conventional single-nozzle systems.

Methodology and Instrumentation


A trap-and-elute microflow LC system (Shimadzu Nexera Mikros) was coupled to a Shimadzu LCMS-8060 triple quadrupole mass spectrometer. Mobile phases were water and acetonitrile with 0.1% formic acid. A C8 trap column (0.3×5 mm, 5 µm) and C8 analytical column (0.2×50 mm, 3 µm) ran gradients at a 5 µL/min elution flow. A Newomics DuoESI source with M3 multi-nozzle emitter provided microflow ionization. Source parameters—voltage, probe position, gas flows, and temperatures—were optimized for maximal sensitivity.

Main Results and Discussion


Optimal precursors for both peptides were the [M+4H]4+ charge states at m/z 1029.30 (semaglutide) and 938.75 (liraglutide). Multiple-spray ESI yielded a 4–8× increase in peak area versus single-nozzle ionization. Systematic tuning of interface voltage, nebulizer gas, and temperature showed signal improvements of 10–200% per parameter. Trap-and-elute with internal/external rinsing minimized carryover to below 0.1% at 200 ng/mL while maintaining throughput.

Benefits and Practical Applications


This workflow enables robust, high-sensitivity quantitation of large therapeutic peptides on existing microflow LC-MS/MS setups, supporting routine analysis in drug development and quality control laboratories.

Future Trends and Opportunities


Further improvements may involve adapting multiple-spray emitters for broader peptide classes, integrating high-throughput autosamplers, and combining with high-resolution MS for enhanced structural characterization.

Conclusion


Employing multiple-spray ESI on a microflow LC-MS/MS platform significantly boosts detection sensitivity and reduces carryover for GLP-1 analogues, demonstrating compatibility with current mass spectrometers and potential for widespread bioanalytical applications.

Instrumentation Used


  • Shimadzu Nexera Mikros trap-and-elute microflow LC
  • Newomics DuoESI source with M3 multi-nozzle emitter
  • Shimadzu LCMS-8060 triple quadrupole MS
  • CERI L-column2 C8 trap column (0.3×5 mm, 5 µm) and analytical column (0.2×50 mm, 3 µm)

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Comprehensive Workflow for Quantitative Bioanalysis of Large Peptides and Proteins: A Case Study of the GLP-1 Receptor Agonist, Semaglutide, in Plasma
COMPREHENSIVE WORKFLOW FOR QUANTITATIVE BIOANALYSIS OF LARGE PEPTIDES AND PROTEINS: A CASE STUDY OF THE GLP-1 RECEPTOR AGONIST, SEMAGLUTIDE, IN PLASMA Authors: Samantha Ferries1, Suraj Dhungana1, Robert S Plumb2Amy Bartlett 1 Affiliations: 1 WatersTM Corporation, Wilmslow, UK, 2 Waters Corporation,…
Key words
skyline, skylinesemaglutide, semaglutidemrm, mrmpeptides, peptidesoptimisation, optimisationpremier, premiermaccoss, maccosswaters, watersmasslynx, masslynxassay, assayworkflow, workflowsilico, silicotandem, tandemacquity, acquitydevelopment
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemass, massmin, mintime, timeabundance, abundanceadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg
Automated SPE Sample Preparation for Bioanalysis of GLP-1 Analogs from Plasma
Automated SPE Sample Preparation for Bioanalysis of GLP-1 Analogs from Plasma Makda Araya and Chelsea Plummer Waters Corporation, Milford MA, USA _________________________________________________________________________________________________________________________________________________ RESULTS INTRODUCTION Glucagon-Like Peptide 1 (GLP-1) analogs, initially intended to treat type II diabetes Mellitus, are currently used…
Key words
µelution, µelutionlixisenatide, lixisenatidesemaglutide, semaglutideoasis, oasisexenatide, exenatidehlb, hlbtirzepatide, tirzepatideliraglutide, liraglutidelix, lixplate, plateexe, exelir, lirtir, tirsem, semandrew
Detection and quantification of GLP-1 analogs in human plasma: A comprehensive analytical approach
Detection and quantification of GLP-1 analogs in human plasma: A comprehensive analytical approach Hao Yang1, Cristina Jacob1, Romain Huguet1, Min Du2 1 Thermo Fisher Scientific, San Jose, CA, United States; 2 Thermo Fisher Scientific, Lexington, MA, United States Abstract Materials…
Key words
semaglutide, semaglutideliraglutide, liraglutidearb, arbstellar, stellaranalogs, analogsdiff, diffscan, scanmellitus, mellitusfragment, fragmentobesity, obesitydiagnosed, diagnosedsettings, settingsdiabetes, diabetesextracted, extractedcomprehensive
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike