Detection and quantification of GLP-1 analogs in human plasma: A comprehensive analytical approach
Posters | 2025 | Thermo Fisher Scientific | MSACLInstrumentation
Accurate quantification of GLP-1 analogs such as semaglutide and liraglutide in plasma is crucial for understanding pharmacokinetics, optimizing dosing regimens and ensuring patient safety in diabetes and obesity therapies.
The study presents a robust LC-MS workflow using Thermo Fisher Stellar MS and Vanquish UHPLC for sensitive detection and quantification of semaglutide and liraglutide in human plasma. It aims to achieve a low limit of quantitation (50 pg/mL) with high precision and accuracy across a wide dynamic range.
Future enhancements may include automated sample preparation, coupling with high-resolution mass spectrometers and extension to other peptide-based therapeutics. Integration with data-driven dosing algorithms could further personalize treatment strategies.
This comprehensive LC-MS method provides a highly sensitive, accurate and reproducible platform for quantifying semaglutide and liraglutide in human plasma, facilitating advanced pharmacokinetic studies and improved patient management in metabolic disease therapies.
LC/MS, LC/MS/MS, LC/Orbitrap, LC/HRMS
IndustriesClinical Research
ManufacturerThermo Fisher Scientific
Summary
Significance of the Topic
Accurate quantification of GLP-1 analogs such as semaglutide and liraglutide in plasma is crucial for understanding pharmacokinetics, optimizing dosing regimens and ensuring patient safety in diabetes and obesity therapies.
Aims and Overview of the Study
The study presents a robust LC-MS workflow using Thermo Fisher Stellar MS and Vanquish UHPLC for sensitive detection and quantification of semaglutide and liraglutide in human plasma. It aims to achieve a low limit of quantitation (50 pg/mL) with high precision and accuracy across a wide dynamic range.
Methodology
- Sample preparation: Protein precipitation from 200 µL plasma with cold acetone, followed by solid phase extraction using an SPE µ-elution plate.
- Chromatography: Separation on a C4 column (2.1×50 mm, 1.7 µm) with a gradient of 0.4% formic acid in water (v/v) and 0.1% difluoroacetic acid in acetonitrile (v/v) at 0.25 mL/min and 60°C.
- Mass spectrometry: Targeted tMS2 acquisition with higher-energy collisional dissociation; monitoring doubly charged y-ions for semaglutide (m/z 1029.3) and liraglutide (m/z 938.4).
Instrumentation Used
- Thermo Scientific Vanquish UHPLC system for chromatographic separation.
- Thermo Scientific Stellar Mass Spectrometer operating in tMS2 mode for high-sensitivity detection.
- Thermo Scientific Chromeleon CDS 7.3.2 software for instrument control, data acquisition and processing.
Main Results and Discussion
- Multiple-fragment-ion quantitation improved sensitivity twofold compared to single-ion monitoring without compromising selectivity.
- Achieved a limit of quantitation of 50 pg/mL for both analytes with signal-to-noise ratios suitable for reliable detection.
- Demonstrated precision (≤15% RSD) and accuracy (≤15% deviation) across three orders of magnitude (0.05–50 ng/mL) for both GLP-1 analogs.
Benefits and Practical Applications
- Enables precise pharmacokinetic profiling and therapeutic drug monitoring of GLP-1 analogs.
- Supports dose optimization and safety assessments in clinical and preclinical studies.
- Streamlined SPE-UHPLC-MS workflow enhances throughput in research and diagnostic laboratories.
Future Trends and Applications
Future enhancements may include automated sample preparation, coupling with high-resolution mass spectrometers and extension to other peptide-based therapeutics. Integration with data-driven dosing algorithms could further personalize treatment strategies.
Conclusion
This comprehensive LC-MS method provides a highly sensitive, accurate and reproducible platform for quantifying semaglutide and liraglutide in human plasma, facilitating advanced pharmacokinetic studies and improved patient management in metabolic disease therapies.
References
- Drucker DJ, Habener JF, Holst JJ. Discovery, characterization, and clinical development of the glucagon-like peptides. Journal of Clinical Investigation. 2017;127(12):4217–4227.
- Nauck MA, Meier JJ. Incretin hormones: Their role in health and disease. Diabetes, Obesity and Metabolism. 2018;20(S1):5–21.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Sensitive LC-MS method for the quantitative analysis of semaglutide and liraglutide in human plasma
2025|Thermo Fisher Scientific|Posters
Sensitive LC-MS method for the quantitative analysis of semaglutide and liraglutide in human plasma Hao Yang1, Ke Ma2, Min Du3 1 Thermo Fisher Scientific, San Jose, CA, United States 2 Thermo Fisher Scientific, Sunnyvale, CA, United States 3 Thermo Fisher…
Key words
semaglutide, semaglutideliraglutide, liraglutidearb, arbquan, quanmin, mincounts, countsmellitus, mellitusobesity, obesitydiagnosed, diagnoseddiabetes, diabetesblank, blankaltis, altisdiff, diffgas, gasdivert
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemass, massmin, mintime, timeabundance, abundanceadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg
Automated SPE Sample Preparation for Bioanalysis of GLP-1 Analogs from Plasma Makda Araya and Chelsea Plummer Waters Corporation, Milford MA, USA _________________________________________________________________________________________________________________________________________________ RESULTS INTRODUCTION Glucagon-Like Peptide 1 (GLP-1) analogs, initially intended to treat type II diabetes Mellitus, are currently used…
Key words
µelution, µelutionlixisenatide, lixisenatidesemaglutide, semaglutideoasis, oasisexenatide, exenatidehlb, hlbtirzepatide, tirzepatideliraglutide, liraglutidelix, lixplate, platelir, lirexe, exetir, tirsem, semautomated
Ultra-sensitive quantitation of therapeutic oligonucleotide in human plasma by a high resolution accurate mass Orbitrap mass spectrometer
2024|Thermo Fisher Scientific|Posters
Ultra-sensitive quantitation of therapeutic oligonucleotide in human plasma by a high resolution accurate mass Orbitrap mass spectrometer Hao Yang1, Min Du2, 1Thermo Fisher Scientific, San Jose, CA, United States, 2Thermo Fisher Scientific, Lexington, MA, United States Abstract We developed a…
Key words
nusinersen, nusinersenfomivirsen, fomivirsenarb, arbhram, hramvanquish, vanquishdiff, diffhorizon, horizonmass, massprecision, precisiondeveloped, developedribonucleic, ribonucleicaccurate, accuratestill, stilliprp, iprpresolution