LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Sensitive LC-MS method for the quantitative analysis of semaglutide and liraglutide in human plasma

Posters | 2025 | Thermo Fisher Scientific | HPLC SymposiumInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research, Pharma & Biopharma
Manufacturer
Thermo Fisher Scientific

Summary

Importance of the Topic


This work addresses the critical need for highly sensitive and accurate quantification of two clinically important GLP-1 analogs, semaglutide and liraglutide, in human plasma. Reliable measurements at low concentrations support pharmacokinetic investigations, therapeutic drug monitoring, and safety assessments in patients with type 2 diabetes and obesity.

Study Aims and Overview


The primary objective was to develop and validate an LC-MS method capable of detecting semaglutide and liraglutide down to 0.1 ng/mL in plasma. The study demonstrates the analytical performance in terms of linear dynamic range, precision, accuracy, and carryover behavior, using each peptide as an internal standard for the other.

Methodology and Instrumentation


Sample Preparation:
  • Stock solutions (1 mg/mL) in methanol; calibration standards from 1 to 1000 ng/mL.
  • Protein precipitation with cold acetone, followed by centrifugation.
  • SPE µ-elution plate for cleanup; 200 µL plasma spiked with peptides and internal standard at 10 ng/mL.

Chromatography and Mass Spectrometry:
  • UHPLC on Hypersil GOLD Peptide column (2.1 × 50 mm, 1.9 µm) at 60 °C.
  • Gradient elution with 0.4% formic acid in water (A) and 0.1% difluoroacetic acid in acetonitrile (B), 35–95% B over 8 min.
  • TSQ Altis Plus triple quadrupole MS in SRM mode; optimized source temperatures, gas flows, and collision energies for quantifier and qualifier ions.

Main Results and Discussion


The method achieved a limit of quantitation of 0.1 ng/mL for both peptides. Calibration was linear over three orders of magnitude (0.1–100 ng/mL), with:
  • Precision ≤ 10% RSD across all levels.
  • Accuracy within ± 20% of nominal values.
  • Carryover below 10% of the LOQ for semaglutide and under 14% for liraglutide after a 100 ng/mL injection.

Chromatographic retention times were consistent (approximately 3.4 min), and the embedded “shark teeth” wash cycles minimized residual signal without extending run times significantly.

Benefits and Practical Applications


This robust LC-MS approach enables:
  • Precise pharmacokinetic profiling of GLP-1 analogs in clinical trials and routine monitoring.
  • Sensitive detection of low-level drug exposure to optimize dosing.
  • Compliance with bioanalytical regulatory guidelines for accuracy, precision, and carryover.

Future Trends and Opportunities


Emerging areas to enhance and extend this work include:
  • Automation of sample preparation to increase throughput.
  • Multiplexed assays for simultaneous analysis of additional peptide therapeutics.
  • Integration of high-resolution mass spectrometry for improved selectivity.
  • Application to real-world clinical studies and personalized dosing strategies.

Conclusion


The presented LC-MS method provides a sensitive, accurate, and efficient solution for quantifying semaglutide and liraglutide in human plasma. Its validated performance supports reliable drug quantitation in pharmacokinetic and therapeutic monitoring applications.

Instrumentation Used


  • Thermo Scientific Vanquish Horizon UHPLC system
  • Thermo Scientific TSQ Altis Plus triple quadrupole mass spectrometer
  • Hypersil GOLD Peptide column (2.1 × 50 mm, 1.9 µm)
  • SPE µ-elution plate for sample cleanup
  • Thermo Scientific Chromeleon CDS software (v7.3.2)

References


  1. Drucker DJ, Habener JF, Holst JJ. Discovery, characterization, and clinical development of the glucagon-like peptides. Journal of Clinical Investigation. 2017;127(12):4217–4227.
  2. Nauck MA, Meier JJ. Incretin hormones: Their role in health and disease. Diabetes, Obesity and Metabolism. 2018;20(S1):5–21.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Detection and quantification of GLP-1 analogs in human plasma: A comprehensive analytical approach
Detection and quantification of GLP-1 analogs in human plasma: A comprehensive analytical approach Hao Yang1, Cristina Jacob1, Romain Huguet1, Min Du2 1 Thermo Fisher Scientific, San Jose, CA, United States; 2 Thermo Fisher Scientific, Lexington, MA, United States Abstract Materials…
Key words
semaglutide, semaglutideliraglutide, liraglutidearb, arbstellar, stellaranalogs, analogsdiff, diffscan, scanmellitus, mellitusfragment, fragmentobesity, obesitydiagnosed, diagnosedsettings, settingsdiabetes, diabetesextracted, extractedcomprehensive
Automated SPE Sample Preparation for Bioanalysis of GLP-1 Analogs from Plasma
Automated SPE Sample Preparation for Bioanalysis of GLP-1 Analogs from Plasma Makda Araya and Chelsea Plummer Waters Corporation, Milford MA, USA _________________________________________________________________________________________________________________________________________________ RESULTS INTRODUCTION Glucagon-Like Peptide 1 (GLP-1) analogs, initially intended to treat type II diabetes Mellitus, are currently used…
Key words
µelution, µelutionlixisenatide, lixisenatidesemaglutide, semaglutideoasis, oasisexenatide, exenatidehlb, hlbtirzepatide, tirzepatideliraglutide, liraglutidelix, lixplate, plateexe, exelir, lirtir, tirsem, semandrew
Improving Sensitivity of GLP-1 Analogues Quantitation Using Multiple Spray ESI Technology on a Microflow LC-MS/MS
ThP 596 Improving Sensitivity of GLP-1 Analogues Quantitation Using Multiple Spray ESI Technology on a Microflow LC-MS/MS Kathleen Luo1, Logan Miller1, Eishi Imoto1, Toshiya Matsubara1 (1) Shimadzu Scientific Instruments, Columbia, MD. 3. Results Glucagon-like peptide-1 (GLP-1) receptor agonists drugs, a…
Key words
microflow, microflowliraglutide, liraglutidesemaglutide, semaglutidenozzle, nozzletrap, trapemitter, emitterionization, ionizationtransition, transitionshowcased, showcasedflexible, flexiblemikros, mikroscharge, chargedistribution, distributionevaluated, evaluatedmulti
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemass, massmin, mintime, timeabundance, abundanceadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike