Forced Degradation Studies of Synthetic Oligonucleotide

Applications | 2025 | Agilent TechnologiesInstrumentation
LC/MS, LC/MS/MS, LC/TOF, LC/HRMS
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Importance of the Topic


Forced degradation studies are essential for assessing the chemical stability and safety of synthetic oligonucleotide therapeutics. As antisense oligonucleotides gain prominence in treating diverse diseases, understanding their degradation pathways under stress conditions guides formulation, storage and regulatory approval. This type of study ensures the identification of critical impurities and informs robust quality control strategies.

Objectives and Study Overview


This application note examines the thermal and oxidative stability of Fomivirsen, a 21-mer phosphorothioate antisense oligonucleotide, using ion-pairing reversed-phase liquid chromatography coupled to quadrupole time-of-flight mass spectrometry (IP-RP LC/Q-TOF). The primary goals are to:
  • Quantify full-length product degradation over time under heat stress.
  • Characterize oxidative modifications induced by hydrogen peroxide.
  • Demonstrate targeted plus impurities (TPI) and sequence confirmation (SC) workflows for detailed degradation profiling.

Methodology and Instrumentation


Sample Preparation and Stress Conditions:
  • Heat stress: 1 mg/mL Fomivirsen incubated at 80 °C for up to 24 hours; aliquots taken at 4, 8 and 24 hours.
  • Oxidative stress: 1 mg/mL sample treated with 0.3 % and 3.0 % H2O2 at room temperature for 2 and 4 hours.

Instrumentation:
  • Agilent 1290 Infinity II bio LC system with AdvanceBio Oligonucleotide column (2.1 × 50 mm, 2.7 μm).
  • Agilent 6545XT AdvanceBio LC/Q-TOF with Dual Jet Stream ESI source.
  • Mobile phases: 15 mM triethylamine and 100 mM HFIP in water (A), methanol (B); gradient from 10 % to 50 % B over 5 minutes.

Data Analysis:
  • Agilent MassHunter BioConfirm software implementing TPI and SC workflows.
  • TPI: detection of shortmers and oxidized linkages with 10 ppm tolerance.
  • SC: MS/MS sequence confirmation with BioScore thresholds (>90 warn, >80 accept).

Main Results and Discussion


Heat Stress Findings:
  • Full-length product (FLP) declined by 15 %, 29 % and 80 % after 4, 8 and 24 hours at 80 °C, respectively.
  • TPI workflow revealed increasing 5'-end truncated shortmers categorized as long (n-1 to n-5), medium (n-6 to n-10) and short (n-11 and above).
  • Medium and short fragments rose sharply after 8 hours, matching long shortmers by 24 hours.

Oxidative Stress Findings:
  • At 0.3 % H2O2, FLP decreased by 63 % and 89 % at 2 hours and 4 hours, respectively; oxidized species represented up to 92 % of total signal.
  • At 3 % H2O2, complete oxidation occurred within 2 hours, generating up to 20 phosphodiester linkages.
  • Oxidation induced coelution and peak fronting due to reduced hydrophobicity of oxidized analogs.

Sequence Confirmation:
  • SC workflow achieved 100 % sequence coverage for FLP and an n-15 shortmer in heat-stressed samples, with BioScores above threshold, demonstrating high confidence in low-abundance fragment identification.

Benefits and Practical Applications


The IP-RP LC/Q-TOF platform combined with targeted workflows provides:
  • High sensitivity and specificity for low-level impurities and degradation products.
  • Rapid, reproducible analysis suitable for quality control during oligonucleotide development.
  • Regulatory compliance by detailed mapping of degradation pathways.

Future Trends and Applications


Advancements in mass spectrometry and bioinformatics will further enhance oligonucleotide analysis by:
  • Increasing throughput with automated data processing and real-time monitoring.
  • Extending workflows to novel chemical modifications (e.g., 2'-ribose or backbone modifications).
  • Integrating orthogonal techniques such as ion mobility for deeper structural insights.

Conclusion


Forced degradation studies using IP-RP LC/Q-TOF and targeted data workflows deliver comprehensive profiles of thermal and oxidative breakdown pathways in synthetic oligonucleotides. The demonstrated sensitivity, reproducibility and sequence confirmation capacity support robust quality control and informed development of next-generation oligonucleotide therapeutics.

Reference


1. EMA Draft Guideline on the Development and Manufacture of Oligonucleotides. 2. Pourshahian, S. Mass Spectrom. Rev. 2021, 40, 75–109. 3. Elzahar, N.M. et al. Anal. Bioanal. Chem. 2018, 410, 3375–3384.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Identification and quantitation of oligonucleotides, impurities, and degradation products
APPLICATION NOTE 73870 Identification and quantitation of oligonucleotides, impurities, and degradation products Haichuan Liu1, Kevin Guo2, Jennifer Sutton1, Keeley Murphy1, Min Du2 1 Thermo Fisher Scientific, San Jose, CA 2 Thermo Fisher Scientific, Boston, MA Keywords: Oligonucleotide, RNA, impurity, purification,…
Key words
oligonucleotide, oligonucleotideimpurities, impuritiesfinder, finderbiopharma, biopharmaabundance, abundancerelative, relativedesalting, desaltingagc, agchplc, hplcvalue, valuesoftware, softwarednapac, dnapaccustom, customintensity, intensitymicroscans
Fast Track to Certainty: Confident Biopharma Decisions with LC-Single Quadrupole Mass Detection
Table of contents Fast Track to Certainty: Confident Biopharma Decisions with LC-Single Quadrupole Mass Detection How single quadrupole LC/MS simplifies identification, purification, and stability assessment in biopharma Table of Contents Introduction��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������� 3 Consolidating Biopharma QC Workflows: LC/UV Versus Single Quadrupole…
Key words
contents, contentstable, tablemass, masspro, proplus, plusabundance, abundancetrastuzumab, trastuzumabmoera, moeraunknown, unknownrelative, relativeabundances, abundancesagilent, agilentmoerc, moercmoe, moethreshold
Oligonucleotide Characterization by Agilent 1290 Infinity II Bio LC and 6545XT AdvanceBio LC/Q-TOF
Application Note Pharma & Biopharma Oligonucleotides Oligonucleotide Characterization by Agilent 1290 Infinity II Bio LC and 6545XT AdvanceBio LC/Q-TOF Oligonucleotide identity, impurities analysis and sequence determination using BioConfirm 12.0 target plus impurities (TPI) and sequence confirmation workflows Authors Introduction Bian…
Key words
oligonucleotide, oligonucleotideaso, asosequence, sequencetpi, tpicounts, countsconfirmation, confirmationacquisition, acquisitionoligonucleotides, oligonucleotidesworkflow, workflowcharge, chargeimpurities, impuritiesbioconfirm, bioconfirmmass, massagilent, agilentfluoro
Confident and sensitive identification of semaglutide degradation products and impurities using a UHPLC-HRAM MS platform
Application note | 003920 Pharma Confident and sensitive identification of semaglutide degradation products and impurities using a UHPLC-HRAM MS platform Authors Application benefits Xuepu Li1, Xiaoxi Zhang1, Min Du2, Roberto Gamez , Sylvia Grosse 3 • The Thermo Scientific™ Hypersil…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgoxidation, oxidationpeptide, peptidedegradation, degradationstressed, stressedimpurities, impuritiesproducts, productsoxidative, oxidativehaegftsdvssylegqaakefiawlvrgrg, haegftsdvssylegqaakefiawlvrgrguhplc, uhplchram, hramfinder, finderbiopharma, biopharmaaegtftsdvssylegqaakefiawlvrgrg
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike