Identification and quantitation of oligonucleotides, impurities, and degradation products
Applications | 2020 | Thermo Fisher ScientificInstrumentation
Oligonucleotide therapeutics are emerging modalities for treating genetic and infectious diseases. Accurate identification and quantitation of full-length sequences, synthesis-related impurities (shortmers, longmers, base-modified species), and degradation products are critical for drug discovery, quality control, and stability studies.
The study aimed to develop a robust data-dependent MS2 (ddMS2) workflow for simultaneous identification, sequence mapping, and relative quantitation of oligonucleotide impurities in a single experiment. Three case studies demonstrate applications:
Ion-pair reversed-phase UHPLC was performed at 60 °C with HFIP/DIPEA modifiers and a 15 min gradient (10–80 % methanol). The mass spectrometer operated in negative-ion mode with high-resolution full scans (120,000 at m/z 200) and data-dependent MS2 on charge states of interest. A stepped normalized collision energy (NCE) approach was optimized (18–20–22 % for 21-mer) to maximize fragment coverage. BioPharma Finder’s Oligonucleotide Analysis workflow was used for sequence mapping, deconvolution of intact masses, and comparative quantitation across multiple runs.
• Optimization of stepped NCE across eleven settings yielded complete fragment coverage of the 21-mer and its shorter impurities (average structural resolution ≤ 1.2).
• In desalting-purified samples, numerous shortmers (n–1 to n–19) were detected down to 0.015 % abundance; HPLC purification reduced total impurity from 2.55 % to 1.18 %.
• Forced thermal degradation at 80 °C led to rapid loss of full-length oligo within 4–6 h, accumulation of shortmers, phosphorylated species, base-loss, depurinated/depryrimidinated fragments, and nearly complete degradation by 24 h.
• Oxidative stress (5 % H2O2) produced stable full-length 21-mer levels but increasing oxidized species over 24 h, with minor changes in shortmer profiles.
• High-molecular-weight impurities (M + n–x) were observed around 9 min retention time only in desalting samples. MS1 deconvolution matched theoretical masses within < 1 ppm. ddMS2 fragmentation and mapping indicated a branched architecture linking shortmers via their 5′ ends to the 3′ base of the full-length oligo.
The combined high-resolution accurate-mass/ddMS2 approach and BioPharma Finder software deliver a streamlined, sensitive, and comprehensive platform for characterizing oligonucleotides, their synthesis impurities, and degradation products. This methodology accelerates quality control, purity assessment, and structural elucidation in therapeutic oligonucleotide development.
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesPharma & Biopharma
ManufacturerThermo Fisher Scientific
Summary
Importance of the Topic
Oligonucleotide therapeutics are emerging modalities for treating genetic and infectious diseases. Accurate identification and quantitation of full-length sequences, synthesis-related impurities (shortmers, longmers, base-modified species), and degradation products are critical for drug discovery, quality control, and stability studies.
Objectives and Study Overview
The study aimed to develop a robust data-dependent MS2 (ddMS2) workflow for simultaneous identification, sequence mapping, and relative quantitation of oligonucleotide impurities in a single experiment. Three case studies demonstrate applications:
- Comparing impurity profiles of a DNA 21-mer purified by desalting versus HPLC.
- Characterizing degradation pathways under accelerated thermal and oxidative stress conditions.
- Elucidating structures of high-molecular-weight branched impurities.
Instrumentation
- Thermo Scientific™ Orbitrap Exploris™ 240 mass spectrometer
- Thermo Scientific™ Vanquish™ Horizon UHPLC system
- Thermo Scientific™ DNAPac™ RP column (2.1 × 50 mm, 4 µm)
- Thermo Scientific™ BioPharma Finder™ 4.0 software
Methodology
Ion-pair reversed-phase UHPLC was performed at 60 °C with HFIP/DIPEA modifiers and a 15 min gradient (10–80 % methanol). The mass spectrometer operated in negative-ion mode with high-resolution full scans (120,000 at m/z 200) and data-dependent MS2 on charge states of interest. A stepped normalized collision energy (NCE) approach was optimized (18–20–22 % for 21-mer) to maximize fragment coverage. BioPharma Finder’s Oligonucleotide Analysis workflow was used for sequence mapping, deconvolution of intact masses, and comparative quantitation across multiple runs.
Main Results and Discussion
• Optimization of stepped NCE across eleven settings yielded complete fragment coverage of the 21-mer and its shorter impurities (average structural resolution ≤ 1.2).
• In desalting-purified samples, numerous shortmers (n–1 to n–19) were detected down to 0.015 % abundance; HPLC purification reduced total impurity from 2.55 % to 1.18 %.
• Forced thermal degradation at 80 °C led to rapid loss of full-length oligo within 4–6 h, accumulation of shortmers, phosphorylated species, base-loss, depurinated/depryrimidinated fragments, and nearly complete degradation by 24 h.
• Oxidative stress (5 % H2O2) produced stable full-length 21-mer levels but increasing oxidized species over 24 h, with minor changes in shortmer profiles.
• High-molecular-weight impurities (M + n–x) were observed around 9 min retention time only in desalting samples. MS1 deconvolution matched theoretical masses within < 1 ppm. ddMS2 fragmentation and mapping indicated a branched architecture linking shortmers via their 5′ ends to the 3′ base of the full-length oligo.
Benefits and Practical Applications
- Combines intact-mass confirmation, sequence-level mapping, and relative quantitation in one LC-MS run.
- Detects trace-level impurities below chromatographic visibility.
- Enables rapid assessment of purification methods and stability profiles for therapeutic oligonucleotides.
- Provides structural insights into complex branched impurities and degradation products.
Future Trends and Opportunities for Use
- Extension of ddMS2 workflows to longer or chemically modified oligonucleotides and siRNA constructs.
- Integration with automated reporting and high-throughput impurity screening pipelines.
- Advances in software algorithms for improved fragment assignment and quantitation accuracy.
- Application to in-process monitoring and release testing in oligonucleotide manufacturing.
Conclusion
The combined high-resolution accurate-mass/ddMS2 approach and BioPharma Finder software deliver a streamlined, sensitive, and comprehensive platform for characterizing oligonucleotides, their synthesis impurities, and degradation products. This methodology accelerates quality control, purity assessment, and structural elucidation in therapeutic oligonucleotide development.
Reference
- Wang F et al. RNA therapeutics on the rise. Nat Rev Drug Discov. 2020;19:441.
- Bajan S, Hutvagner G. RNA-based therapeutics: from antisense oligonucleotide to miRNAs. Cells. 2020;9:137.
- Rossi JJ et al. Oligonucleotides and the COVID-19 pandemic: a perspective. Nucleic Acid Ther. 2020;30:129.
- Sutton JM et al. Current state of oligonucleotide characterization using LC-MS. J Am Soc Mass Spectrom. 2020;31:1775.
- El Zahar NM et al. Chromatographic approaches for therapeutic oligonucleotide impurities. Biomed Chromatogr. 2018;32:e4088.
- Pourshahian S. Therapeutic Oligonucleotides, impurities, degradants, and their characterization by MS. Mass Spectrom Rev. 2019;doi:10.1002/mas.21615.
- Capaldi D et al. Impurities in oligonucleotide drug substances and products. Nucleic Acid Ther. 2017;27:309.
- Liu HC et al. Oligonucleotide mapping using BioPharma Finder software. Thermo Fisher App Note 73789;2020.
- Kurata C et al. High molecular weight impurities in synthetic phosphorothioate oligonucleotides. Bioorg Med Chem Lett. 2006;16:607.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Oligonucleotide mapping using BioPharma Finder software
2020|Thermo Fisher Scientific|Applications
APPLICATION NOTE 73789 Oligonucleotide mapping using BioPharma Finder software Authors: Haichuan Liu1, Kevin Guo2, Jennifer Sutton1, Min Du2 Thermo Fisher Scientific, San Jose, CA Thermo Fisher Scientific, Boston, MA 1 2 Keywords: Oligonucleotide, DNA, RNA, data dependent acquisition, tandem mass…
Key words
pgd, pgdpad, padptd, ptdpcd, pcdptdpcd, ptdpcdoligonucleotides, oligonucleotidesoligonucleotide, oligonucleotidestepped, steppedpgr, pgrfinder, finderpur, purbiopharma, biopharmance, ncerelative, relativeintensity
Streamlining characterization and monitoring of oligonucleotide impurities using an Orbitrap-based LC-HRAM-MS platform
2022|Thermo Fisher Scientific|Applications
Application note | 001398 Biopharma Streamlining characterization and monitoring of oligonucleotide impurities using an Orbitrap-based LC-HRAM-MS platform Application benefits Authors Hao Yang , Keeley Murphy , Yi Zhang , 1 2 3 • Comprehensive characterization of oligonucleotides and their impurities…
Key words
oligonucleotide, oligonucleotideflp, flporbitrap, orbitrapexploris, explorisimpurities, impuritiesrna, rnaimpurity, impurityvanquish, vanquishmass, masseworkflow, eworkflowfull, fullchromeleon, chromeleonsequence, sequencecharacterization, characterizationrelative
Characterization of a synthetic double stranded siRNA using high-resolution mass spectrometry
2021|Thermo Fisher Scientific|Applications
APPLICATION BRIEF 74058 Characterization of a synthetic double stranded siRNA using high-resolution mass spectrometry Authors: Haichuan Liu1, Kevin Guo2, Julia Baek3, Jennifer Sutton1, Keeley Murphy1, Min Du2 Thermo Fisher Scientific, San Jose, CA 1 2 Thermo Fisher Scientific, Cambridge, MA…
Key words
sense, senseantisense, antisenseoligonucleotides, oligonucleotidessirna, sirnaabundance, abundancestranded, strandedrelative, relativedipea, dipeavanquish, vanquishdouble, doublediastereomers, diastereomersoligonucleotide, oligonucleotideacu, acuthermo, thermouga
Confident and sensitive identification of semaglutide degradation products and impurities using a UHPLC-HRAM MS platform
2025|Thermo Fisher Scientific|Applications
Application note | 003920 Pharma Confident and sensitive identification of semaglutide degradation products and impurities using a UHPLC-HRAM MS platform Authors Application benefits Xuepu Li1, Xiaoxi Zhang1, Min Du2, Roberto Gamez , Sylvia Grosse 3 • The Thermo Scientific™ Hypersil…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgoxidation, oxidationpeptide, peptidedegradation, degradationstressed, stressedimpurities, impuritiesproducts, productsoxidative, oxidativehaegftsdvssylegqaakefiawlvrgrg, haegftsdvssylegqaakefiawlvrgrguhplc, uhplchram, hramfinder, finderbiopharma, biopharmaaegtftsdvssylegqaakefiawlvrgrg