Enhancing protein quantification and sample throughput with TMTpro 32plex label reagents and extended supporting features from the Orbitrap Ascend MultiOmics mass spectrometer
Technical notes | 2026 | Thermo Fisher ScientificInstrumentation
LC/MS, LC/MS/MS, LC/Orbitrap, LC/HRMS, Standards and chemicals
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Summary
Enhancing protein quantification and sample throughput with TMTpro 32plex reagents and the Orbitrap Ascend MultiOmics mass spectrometer — Technical note summary
Significance of the topic
- Multiplexed isobaric labeling has become essential for high-throughput quantitative proteomics because it reduces run-to-run variability, minimizes missing values, and increases statistical power across many samples.
- The TMTpro 32plex reagent set substantially increases sample multiplexing capacity compared with previous generations, enabling large-cohort and clinical studies with improved cost-efficiency and reduced batch effects.
- Evaluating the instrument and data-processing requirements for accurate separation and quantification of closely spaced reporter ions (Δm ≈ 3 mDa for certain deuterated channels) is critical to realize the full potential of this reagent set.
Goals and study overview
- Assess performance of TMTpro 32plex label reagents combined with the Orbitrap Ascend MultiOmics Tribrid mass spectrometer for highly multiplexed quantitative proteomics.
- Determine Orbitrap resolving power and spectral-processing strategies required to separate the ∼3 mDa mass differences introduced by deuterated reporter channels.
- Compare acquisition modes (MS2 vs. real-time search with synchronous precursor selection MS3) and resolution settings in terms of identification numbers, quantitative accuracy, and throughput.
Methodology
- Sample designs: TMTpro 32plex-labeled HeLa digests with controlled channel mixtures (1:4 and 1:10 between deuterated and non-deuterated sub-plexes) and HeLa background spiked with a six-protein digest at multiple concentrations (100–800 fmol/µg) to assess quantitative performance and interference effects.
- Sample preparation: peptide labeling post-digestion, pooling, cleanup using EasyPep MS sample prep/cleanup kits prior to LC-MS/MS.
- LC setup: direct injection on a Vanquish Neo UHPLC coupled to an EASY-Spray PepMap Neo C18 column (75 µm × 500 mm, 2 µm), column heated to 40 °C. A short-gradient, 15 samples-per-day (SPD) UHPLC method was used to balance throughput and chromatographic performance.
- MS acquisition strategies: data-dependent acquisition (DDA) with either MS2-based quantification or real-time search (RTS) with SPS MS3. Full MS scans at 120k resolving power (200 m/z eFT) were used; MS2/MS3 resolving power varied (30k, 45k, 60k TurboTMT using ΦSDM, 75k eFT, 90k eFT, 120k eFT) to test separation of close reporter ions and trade-offs between resolution and duty cycle.
- Spectral processing: PhiSDM (TurboTMT) algorithm was applied to shorten Orbitrap transients while maintaining effective resolution in the reporter mass range. Proteome Discoverer 3.3 was used for identification and quantification, with Reporter Ions Quantifier node (11 ppm integration tolerance, Most Confident Centroid) and the Reporter Ions Control Channel Normalizer node for sub-plex scaling and normalization.
Used instrumentation
- Thermo Scientific Orbitrap Ascend MultiOmics Tribrid mass spectrometer with EASY-Spray source.
- Thermo Scientific Vanquish Neo UHPLC system (pump/autosampler).
- EASY-Spray PepMap Neo UHPLC Column, 75 µm × 500 mm, 2 µm C18.
- TMTpro 32plex label reagents and supporting consumables (TMTpro 16plex for comparison, EasyPep kits, Pierce protein digest standards).
- Proteome Discoverer software v3.3 for search, quantification, and normalization.
Main results and discussion
- Resolving power requirements: direct-infusion experiments with mixtures of close-mass channels established that reporter ions with Δm ≈ 3 mDa are not well-separated at 60k eFT, are partially resolved at 75k eFT (≈5% baseline), and are baseline-resolved at 90k eFT and higher. Application of the ΦSDM (TurboTMT) algorithm allows shorter transients (e.g., 45k TurboTMT, 60k TurboTMT) while retaining sufficient effective resolution in the reporter-ion region.
- Acquisition trade-offs: using higher eFT resolution (75k or 90k) improves reporter separation but lengthens maximum injection times and reduces MS/MS acquisition rate, decreasing identified/quantified peptide and protein numbers. TurboTMT (e.g., 45k TurboTMT) provides a superior balance of speed and quantification for 32plex experiments.
- Identification and quantification: real-time search with SPS MS3 at 45k TurboTMT for MS3 yielded protein quantification performance for the 32plex comparable to the 16plex (difference <5% in quantified proteins). Increasing MS3 resolution to 75k or 90k reduced the number of quantified proteins (≈10% fewer) due to the slower duty cycle. Pure MS2-based workflows also matched 16plex performance when using 45k TurboTMT, but higher-resolution MS2 decreased quantified IDs by 21–28% for 32plex.
- Quantitative accuracy and interference: co-isolation from background matrix (HeLa) distorts reporter ion ratios, and MS2 acquisition is more susceptible to this interference. RTS with SPS MS3 mitigates ratio distortion and delivers improved accuracy and precision for low-abundance or heavily co-isolated peptides.
- Throughput and completeness: a single 32plex run produced more fully quantified proteins and peptides than two separate 16plex runs (single 32plex RTS-SPS MS3 produced ≈8% more quantified proteins and ≈22% more peptides versus two 16plex runs), reflecting fewer missing values and better inter-sample consistency.
- Retention time and normalization: a small retention time shift (≈0.5–1 s) between deuterated and non-deuterated tag sub-plexes was observed; Proteome Discoverer 3.3 provides a Control Channel Normalizer to scale and correct sub-plex abundances for this effect, recovering accurate channel-level quantification.
Benefits and practical applications of the method
- Doubling of multiplexing capacity (to 32 channels) increases sample throughput per LC-MS run, reduces batch effects and missing-value propagation across runs, and lowers per-sample cost for large studies.
- Combination of TMTpro 32plex with an instrument capable of high mass accuracy and flexible resolution modes (Orbitrap Ascend) plus RTS-SPS MS3 yields robust quantification with improved accuracy in complex matrices.
- Approach is well suited for clinical proteomics, multi-condition experimental designs, population-scale studies, and comparative experiments where subtle abundance changes (<10%) are relevant.
Future trends and potential uses
- Further optimization of spectral-processing algorithms (e.g., enhanced ΦSDM adaptations) and real-time search workflows will continue to improve the balance between effective resolving power and acquisition speed for high-plex reagents.
- Hardware improvements reducing transient times or increasing parallelization will enable even higher multiplexing without sacrificing identifications.
- Integration of 32plex reagents with advanced sample-prep automation, data-independent acquisition hybrids, or single-cell proteomics workflows may expand applicability to larger cohorts and higher-throughput pipelines.
- Continued development of normalization and interference-correction tools in data-analysis platforms will improve quantitative confidence in highly multiplexed experiments, particularly in clinical or heterogeneous sample sets.
Conclusion
- TMTpro 32plex reagents combined with the Orbitrap Ascend MultiOmics MS enable a substantial increase in multiplexed sample throughput while maintaining accurate quantification when appropriate resolving power and spectral-processing strategies are applied.
- The study demonstrates that TurboTMT-enabled mid-range resolving powers (e.g., 45k TurboTMT) used with real-time search and SPS MS3 achieve the best compromise between quantitative performance and identification yield for 32plex experiments; full eFT resolutions (75–90k) provide cleaner reporter separation but at the cost of throughput.
- Adoption of 32plex workflows reduces missing values across samples, increases per-run quantified protein and peptide counts relative to running multiple lower-plex experiments, and is particularly advantageous for large-scale and clinical proteomics studies.
References
- Pappireddi N, Martin L, Wühr M. A Review on Quantitative Multiplexed Proteomics. Chembiochem. 2019 May 15;20(10):1210–1224. doi:10.1002/cbic.201800650.
- Zuniga NR, Frost DC, Kuhn K, Shin M, Whitehouse RL, Wei TY, He Y, Dawson SL, Pike I, Bomgarden RD, Gygi SP, Paulo JA. Achieving a 35-Plex Tandem Mass Tag Reagent Set through Deuterium Incorporation. J Proteome Res. 2024 Nov 1;23(11):5153–5165. doi:10.1021/acs.jproteome.4c00668.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Enhancing protein quantification and sample throughput with TMTpro 32-plex reagents and extended supporting features from the Thermo Scientific Orbitrap Ascend MultiOmics Tribrid Mass Spectrometer
2024|Thermo Fisher Scientific|Posters
Poster # P-I-0130 Enhancing protein quantification and sample throughput with TMTpro 32-plex reagents and extended supporting features from the Thermo Scientific Orbitrap Ascend MultiOmics Tribrid Mass Spectrometer Jingjing Huang1, Dustin Frost2, David Bergen1, Ryan D. Bomgarden2, Rosa Viner1, Graeme McAlister1,…
Key words
deuterated, deuteratedchannels, channelsnormalized, normalizedagc, agcreporter, reporterabundance, abundanceorbitrap, orbitrapquan, quanabundances, abundancesexlusion, exlusionnondeuterated, nondeuteratedeqsgtiylqhadeerek, eqsgtiylqhadeerekgavaedgdelrtepeak, gavaedgdelrtepeakvvadgaglpgedwvfvssk, vvadgaglpgedwvfvsskplexes
Characterizing 32-plex TMTpro reagents for high-throughput quantitative proteomics on Orbitrap platforms
2025|Thermo Fisher Scientific|Posters
Characterizing 32-plex TMTpro reagents for high-throughput quantitative proteomics on Orbitrap platforms Dustin Frost1, Frank Berg2, Kai Fritzemeier2, Pedro Navarro2, David M. Horn3, Ryan Bomgarden1 Figure 1. TMTpro 35-plex isotopic configurations 560.980 m/z (+3) 127D:127C 13C 127.12476 m/z Learn more at…
Key words
deuterated, deuteratedtmtpro, tmtproturbotmt, turbotmtquantified, quantifiedchannels, channelsreferenced, referencedabundances, abundancespeptides, peptidesabundance, abundancelabeled, labeledsets, setsorbitrap, orbitrapthermo, thermoset, setproteins
Expanding TMTpro reagents to 32-plex for high-throughput quantitative proteomics on Orbitrap platforms 
2024|Thermo Fisher Scientific|Posters
P-I-0120 Expanding TMTpro reagents to 32-plex for high-throughput quantitative proteomics on Orbitrap platforms Dustin Frost1, Joao A. Paulo2, Steven P. Gygi2, Karsten Kuhn3, Ian Pike3, Ryan Bomgarden1 2Harvard Medical School, Boston, MA, USA 3Proteome Sciences, London, UK Figure 8. TMTpro…
Key words
deuterated, deuteratedtmtpro, tmtproturbotmt, turbotmtquantified, quantifiedreferenced, referencedorbitrap, orbitrapchannels, channelslabeled, labeledsets, setsnon, nonpeptides, peptideshela, helathermo, thermoabundance, abundancescientific
Enhancing the resolving power on an Orbitrap Astral Zoom mass spectrometer for TMTPro 35plex applications
2025|Thermo Fisher Scientific|Posters
Proteomics Enhancing the resolving power on an Orbitrap Astral Zoom mass spectrometer for TMTPro 35plex applications Julia Kraegenbring1; Martin Zeller1; Tabiwang N. Arrey1, Bernard Delanghe1; Christopher Rathje1; Eduard Denisov1; Robert Ostermann1; Florian Bonn1; Alexander Wagner1; Dustin Frost2; Ryan Bomgarden2; Eugen…
Key words
groups, groupsquantified, quantifiedquan, quantmt, tmtpeptide, peptidereporter, reporterastral, astralprotein, proteinidentified, identifiedknocked, knockedagc, agcscheme, schemenovel, novelscan, scanintegration