Robust Capillary and Low-Microflow LC-MS with Improved Acidic Peptide Recovery Using BioResolve™ 300 μm ID Columns

Applications | 2026 | WatersInstrumentation
LC/MS, LC/MS/MS, Consumables, LC columns, LC/TOF, LC/HRMS
Industries
Proteomics
Manufacturer
Waters

Summary

Significance of the topic


Proteomics workflows increasingly rely on capillary and low-microflow liquid chromatography mass spectrometry (LC-MS) to boost sensitivity while conserving sample and solvents. Columns with a 300 µm internal diameter enable low-microflow operation that improves electrospray ionization efficiency and reduces sample consumption — critical advantages when working with limited or precious proteomic samples. However, interactions between acidic analytes (including phosphopeptides) and stainless-steel column hardware can cause analyte loss, peak tailing and variable responses, undermining identification and quantitation. This study evaluates BioResolve Peptide 300 µm ID columns that incorporate MaxPeak High Performance Surfaces (HPS) Technology to mitigate these issues and improve acidic peptide recovery and chromatographic robustness in capillary/low-microflow proteomics applications.

Study objectives and overview


The application note aims to compare chromatographic performance and MS response of Waters BioResolve Peptide C18 RP columns with MaxPeak Premier (HPS) hardware to equivalent stainless-steel peptide columns under capillary/low-microflow conditions. Key goals were to assess:
  • Recovery and peak shape for acidic and phosphorylated peptides.
  • Need for column conditioning and stability across injections.
  • Peak capacity and column-to-column reproducibility.
  • Suitability of the 300 µm ID HPS columns for routine proteomics workflows targeting acidic peptide populations.

Methodology


Sample and analytes
The test sample was a MassPREP Enolase Digest with phosphopeptides mix reconstituted in 0.1% formic acid. Selected peptides monitored included acidic and phosphorylated sequences (e.g., T51 with multiple Glu/Asp residues, T19p with a phosphorylated serine) and a non-acidic reference peptide (T18).
Chromatographic conditions
An ACQUITY UPLC M-Class system was configured for 300 µm ID column operation with low-microflow plumbing. Columns compared were:
  • Waters BioResolve Peptide C18 RP, MaxPeak Premier, 1.7 µm, 300 Å, BEH, 0.3 × 50 mm.
  • nanoEase M/Z Peptide BEH C18, 1.7 µm, 300 Å, 0.3 × 50 mm (stainless-steel hardware reference).
Other notable LC parameters: column temperature 60 °C, sample temperature 6 °C, injection volume 0.5 µL, mobile phases 0.1% formic acid in water (A) and 0.1% formic acid in acetonitrile (B). 4σ peak capacity calculations were applied for separation performance assessment.
Mass spectrometry and data processing
A low-flow ESI probe coupled to a Xevo G3 detector was used in positive ESI mode (mass range 50–2000 m/z, cone voltage 30 V, capillary voltage 2.50 kV). Data acquisition and processing used MassLynx and waters_connect software. Extracted ion chromatograms (XICs) and total ion chromatograms (TICs) tracked peptide responses across multiple injections.

Used instrumentation


  • ACQUITY UPLC M-Class System (Waters) with ZenFit low-ID tubing for capillary flow connections.
  • Waters BioResolve Peptide C18 RP Column, MaxPeak Premier Technology, 0.3 × 50 mm, 1.7 µm, 300 Å.
  • nanoEase M/Z Peptide BEH C18 Column (stainless-steel reference), 0.3 × 50 mm, 1.7 µm, 300 Å.
  • Xevo G3 mass detector with low-flow ESI probe.
  • QuanRecovery sample vials; MassLynx and waters_connect informatics tools.

Main results and discussion


Improved acidic peptide recovery and peak shape
Compared to the stainless-steel column, the MaxPeak HPS BioResolve column showed substantially higher signal for strongly acidic peptides (notably the multi-Glu/Asp peptide T51) on the very first injection. Phosphopeptide T19p exhibited better peak symmetry and reduced tailing on the HPS hardware during initial injections. In contrast, the stainless-steel column suffered from poor T51 recovery and pronounced T19p tailing on early injections, requiring multiple injections (conditioning) to approach comparable performance.
Minimal conditioning required
Total ion chromatograms revealed that the BioResolve HPS column produced highly similar profiles between the first and tenth injections, indicating negligible conditioning is needed. The stainless-steel column showed notable intensity increases for several peaks between injection 1 and 10, consistent with analyte–hardware interactions that are gradually passivated by conditioning.
Peak capacity and long-term performance
Peak capacities calculated from the tenth injection were comparable between HPS and stainless-steel columns, indicating that the surface treatment does not compromise chromatographic resolution. The HPS column additionally delivered higher signal intensity for some acidic targets while maintaining equivalent separation efficiency.
Column-to-column reproducibility
Measurements on three independent BioResolve 300 µm ID columns demonstrated tight reproducibility: relative retention time RSDs were below 1% and relative peak area RSDs were under 5% across monitored peptides. This indicates robust manufacturing consistency and reliable transferability between columns.
Quantitative trends across injections
For the T51 acidic peptide, the HPS column showed high response on injection one with only a modest increase over the first three injections before stabilizing by the fourth. The stainless-steel column started with very low response and required up to ten injections to approach the HPS response. For T19p tailing factors, the HPS column produced acceptable tailing from injection one while the stainless-steel column required multiple injections (≈5 or more) to reduce tailing to similar levels.

Practical advantages and applications


  • Higher initial recovery for acidic and phosphorylated peptides reduces sample loss and minimizes the need for extended column conditioning, increasing throughput for routine analyses.
  • Improved peak shape and higher signal for problematic acidic species enhance identification and quantitation reliability in discovery and targeted phosphoproteomics workflows.
  • Comparable peak capacity to conventional hardware ensures no trade-off between resolution and surface passivation benefits.
  • Excellent column-to-column reproducibility supports method transferability and routine use in laboratories requiring consistent performance across batches.

Summary of figures and tables


  • TIC comparisons illustrated that BioResolve HPS columns present stable total signal and peak profiles between injection 1 and 10, whereas stainless-steel columns show substantial increases in several peak intensities with conditioning.
  • XIC overlays for selected peptides highlighted markedly superior first-injection response for acidic peptide T51 and improved peak symmetry for phosphopeptide T19p on the HPS column; stainless-steel columns needed multiple conditioning injections to reach similar performance.
  • Reproducibility charts from three BioResolve columns reported retention time RSDs <1% and peak area RSDs <5% for monitored peptides, reflecting robust inter-column consistency.

Future trends and potential applications


  • Wider adoption of HPS-style inert hardware coatings in capillary and low-microflow LC-MS could become standard practice for peptide and phosphopeptide analysis, improving robustness of large-scale proteomics efforts.
  • Integration of inert-surface columns into automated, high-throughput proteomics pipelines will reduce method development time by minimizing conditioning steps.
  • Further optimization and testing with very low-abundance or highly acidic proteoforms (e.g., heavily phosphorylated peptides) may expand applicability to targeted phosphoproteomics and clinical biomarker assays.
  • Coupling HPS columns with next-generation low-flow ion sources and advanced informatics is likely to boost sensitivity and quantitative accuracy for limited-sample analyses (single-cell proteomics, micro-sampled clinical specimens).

Conclusion


BioResolve Peptide 300 µm ID columns employing MaxPeak Premier HPS Technology provide clear performance advantages for capillary and low-microflow LC-MS proteomics, particularly when acidic and phosphorylated peptides are of interest. The HPS hardware substantially reduces analyte–component interactions, delivering higher recovery and improved peak shape from the first injection, while preserving peak capacity and offering excellent column-to-column reproducibility. These attributes simplify method setup, reduce conditioning time, and improve data quality for routine proteomics workflows focused on acidic peptide populations.

References


1. Bian Y., Gao C., Kuster B. On the Potential of Micro-Flow LC-MS/MS in Proteomics. 2022;19(3):153–164.
2. Lennon S., et al. High-Throughput Microbore UHPLC–Ion Mobility–MS-Based Proteomics Methodology for Exploratory Serum Analysis in Large Cohort Studies. J. Proteome Res. 2021;20(3):1705–1715.
3. Zurawska M., Basik M., Aguilar-Mahecha A., Dadlez M., Domanski D. A Micro-Flow, High-pH, Reversed-Phase Peptide Fractionation and Collection System for Targeted and In-Depth Proteomics of Low-Abundance Proteins. Methods. 2023;11:102306.
4. Berthelette K., Collins C., Walter T. H. Improving Sensitivity and Analytical Method Greenness using MaxPeak Premier 1.0 mm ID Columns. Waters Application Note. 720009221. January 2026.
5. Hanna C. M., Koza S. M., Addepalli B. Enhanced Recovery and Peak Shape of Acidic Peptides with BioResolve 1 mm ID Columns with MaxPeak Premier Technology. Waters Application Note. 720009231. February 2026.
6. Hanna C. M., Koza S. M., Addepalli B. Benchmarking Resolution and Recovery of BioResolve 1 mm ID C18 RP Columns with MaxPeak Premier Technology. Waters Application Note. 720009274. March 2026.
7. Nguyen J. M., Rzewuski S. C., Lauber M. A. Enhancing Phosphopeptide Quantitation Using ACQUITY Premier Peptide CSH C18 Columns. Waters Application Note. 720007211. March 2021.
8. Reed C., Hong P., Wong N., Birdsall R. E. Improving Peptide Mapping Separations Containing Phosphopeptides Using MaxPeak Premier Column Technology on an ACQUITY Premier System. Waters Application Note. 720008136. December 2023.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Enhanced Recovery and Peak Shape of Acidic and Phosphopeptides Using Waters BioResolve™ Premier 1 mm ID Columns
Enhanced Recovery and Peak Shape of Acidic and Phosphopeptides Using Waters BioResolve™ Premier 1 mm ID Columns Caitlin M. Hanna1; Stephan M. Koza1; Balasubrahmanyam Addepalli1 1. Waters Corporation, Milford, MA USA; Introduction Improved Recovery and Peak Shape of Acidic Analytes…
Key words
premier, premieracidic, acidicphosphopeptides, phosphopeptidesmicroflow, microflowmaxpeak, maxpeakacquity, acquitycolumns, columnshps, hpsmitigate, mitigateinteractions, interactionstechnology, technologymix, mixfavored, favoredshape, shapeimpact
Enhanced Recovery and Peak Shape of Acidic Peptides with BioResolve™ 1 mm ID Columns with MaxPeak™ Premier Technology
Application Note Enhanced Recovery and Peak Shape of Acidic Peptides with BioResolve™ 1 mm ID Columns with MaxPeak™ Premier Technology Caitlin M. Hanna, Stephan M. Koza, Balasubrahmanyam Addepalli Waters Corporation, United States Published on February 16, 2026 Abstract Microflow chromatography…
Key words
premier, premiertechnology, technologymicroflow, microflowmaxpeak, maxpeakshape, shapepeak, peakcolumns, columnsacidic, acidicpeptides, peptidesrecovery, recoveryhps, hpsprivacy, privacyproteomics, proteomicscolumn, columnfavored
Benchmarking Resolution and Recovery of BioResolve™ 1 mm ID C18 RP Columns with MaxPeak™ Premier Technology
Application Note Benchmarking Resolution and Recovery of BioResolve™ 1 mm ID C18 RP Columns with MaxPeak™ Premier Technology Caitlin M. Hanna, Stephan M. Koza, Balasubrahmanyam Addepalli Waters Corporation, United States Published on March 11, 2026 Abstract The BioResolve Peptide C18…
Key words
technology, technologypremier, premieracidic, acidicrecovery, recoverypeptide, peptidemaxpeak, maxpeakshape, shapehladpsk, hladpsknvplpyk, nvplpykvnqigptlsepsik, vnqigptlsepsikieeelgdnavfagenfhhgdk, ieeelgdnavfagenfhhgdkieeelgdnavfagenfhhgdkl, ieeelgdnavfagenfhhgdklphosphorlyated, phosphorlyatedvnqigptlsesik, vnqigptlsesikprivacy
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology Analytical Solutions Using MaxPeak High Performance Surfaces (HPS) Technology for Biopharmaceutical Therapeutics Biopharmaceutical therapeutics have consistently been the fastest growing segment within the pharmaceutical space and require advances…
Key words
premier, premieracquity, acquityglycan, glycanmaxpeak, maxpeaknucleotide, nucleotideculture, culturehps, hpspeptide, peptideintact, intactsystem, systembioaccord, bioaccordcolumn, columnread, readprotein, proteinglycans
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike