Enhanced Recovery and Peak Shape of Acidic and Phosphopeptides Using Waters BioResolve™ Premier 1 mm ID Columns

Posters | 2026 | Waters | ASMSInstrumentation
Consumables, LC columns, LC/MS, LC/MS/MS, LC/TOF, LC/HRMS
Industries
Proteomics
Manufacturer
Waters

Summary

Importance of the topic


Capillary and microflow LC–MS workflows are increasingly adopted in high-throughput proteomics because they offer higher sensitivity and lower solvent consumption. A persistent analytical problem in these regimes is poor recovery and distorted peak shape of acidic peptides and phosphopeptides caused by non-specific adsorption to stainless-steel column hardware. This reduces sensitivity, increases conditioning time, degrades quantitation and complicates phosphoproteome analyses. Addressing hardware-induced analyte loss is therefore critical to improving robustness and throughput in modern proteomics and LC–MS assays.

Objectives and study overview


The study evaluates Waters BioResolve Peptide C18 RP columns incorporating MaxPeak Premier High Performance Surfaces (HPS) technology (1 mm and 300 µm ID formats) for capillary and microflow LC–MS proteomics. Goals were to determine whether HPS-treated column hardware improves first-injection recovery and peak shape of acidic peptides and phosphopeptides, reduces conditioning requirements, and produces cleaner MS spectra compared with equivalent stainless-steel and competitor columns.

Methodology


Samples and analytes:
  • MassPREP Enolase digest spiked with a phosphopeptides mix; probe peptides highlighted include T51 (IEEELGDNAVFAGENFHHGDK), T19p (HLADLpSK) and T35 (WLTGPQLADLYHSLMK).

Chromatography and systems:
  • Columns: BioResolve Peptide C18 RP, MaxPeak Premier Technology, BEH particles (1.7 µm, 300 Å) in formats 1.0 x 50 mm, 1.0 x 100 mm and 0.3 x 50 mm (300 µm ID).
  • LC systems: Waters ACQUITY UPLC M-Class (microflow) and ACQUITY Premier (analytical-scale) were used to compare performance across flow regimes.
  • Mobile phases: 0.1% formic acid in water (A) and acetonitrile (B).
  • Column temperature: 60 °C; sample temperature: 6 °C.

Mass spectrometry:
  • Xevo G3 QToF with low-flow ESI probe, positive ionization, mass range 50–2000 m/z. Source conditions: capillary voltage 2.5 kV, source 120 °C, desolvation 250 °C, desolvation gas 350 L/hr, cone gas 50 L/hr.

Comparators and metrics:
  • Performance of HPS-treated BioResolve columns was compared with conventional stainless-steel hardware columns (equivalent chemistries) and with three competitor peptide C18 columns (labeled Columns K, H and Y in the dataset).
  • Key metrics: extracted ion chromatograms (XICs), total ion chromatograms (TICs), peak area (recovery), USP tailing factor, peak capacity, first-injection behavior and resulting MS spectral quality (signal-to-noise, baseline noise, presence of column bleed).

Used instrumentation


  • Waters ACQUITY UPLC M-Class System.
  • Waters ACQUITY Premier System.
  • Waters BioResolve Peptide C18 RP Columns with MaxPeak Premier (1.0 x 50 mm, 1.0 x 100 mm, 0.3 x 50 mm; 1.7 µm BEH, 300 Å).
  • Xevo G3 QToF Mass Spectrometer with low-flow ESI probe.

Main results and discussion


Improved first-injection performance:
  • BioResolve MaxPeak Premier columns delivered high recovery and low tailing for acidic peptides (including phosphopeptides) on the very first injection. Equivalent stainless-steel hardware columns displayed low recovery and pronounced tailing on the first injection that only improved after repeated conditioning.

Reduced need for column conditioning:
  • Because HPS-treated hardware minimizes non-specific adsorption sites, BioResolve columns reach reproducible chromatography faster, reducing instrument downtime and preconditioning solvent usage required to achieve acceptable recovery and peak shape on stainless-steel columns.

Consistent benefits across flow regimes and IDs:
  • 1 mm ID BioResolve columns are compatible with both microflow (M-Class) and analytical (Premier) UHPLC systems. Although peak capacity measured on the ACQUITY Premier system was somewhat reduced (attributed to increased post-column dispersion), performance remained comparable to standard 2.1 x 50 mm analytical columns run on the same system.
  • 300 µm ID BioResolve columns demonstrated similar advantages in capillary and low-microflow proteomics, showing improved recovery and peak shape relative to stainless-steel counterparts.

Cleaner MS spectra and higher signal quality:
  • Compared with three competitor columns, BioResolve produced the cleanest mass spectra for tested peptides. For the T35 peptide, the triply charged ion signal was >40% higher on BioResolve than on the alternative columns. Other columns showed elevated baseline noise, co-elution due to broad asymmetric acidic-peptide peaks, and in one case column bleed producing a strong signal at m/z 223.06.

Empirical examples and trends:
  • XICs and TICs illustrated that acidic peptides (T19p, T51) exhibit markedly improved peak shape and area on BioResolve columns from injection one, whereas comparator columns required multiple injections to approach similar behavior.

Benefits and practical applications


  • Improved sensitivity and quantitation for acidic peptides and phosphopeptides, important for phosphoproteomics, PTM analysis and workflows targeting acidic analytes.
  • Faster time-to-data and reduced solvent consumption due to lower conditioning requirements—beneficial in high-throughput laboratories and production environments.
  • Compatibility with both microflow and analytical-scale UHPLC systems simplifies method transfer and supports diverse lab setups.
  • Cleaner MS spectra increase confidence in identification and quantitation by reducing baseline noise and co-elution artifacts.

Future trends and potential uses


  • Broader adoption of surface-passivated hardware: HPS-like coatings will likely expand across other column formats and instrument components to mitigate surface adsorption of challenging analytes (e.g., acidic peptides, phosphorylated species, metal-chelating compounds).
  • Integration with miniaturized and multiplexed workflows: improved first-injection performance encourages wider use of low-flow formats in large-cohort proteomics and automated platforms.
  • Complementary advances: combining hardware surface treatments with optimized stationary phases, ion-mobility separations and enhanced source designs to further improve sensitivity and spectral clarity.
  • Application extension: clinical and regulated labs analyzing low-abundance acidic biomarkers or performing phosphosite quantification will benefit from reduced analyte loss and enhanced robustness.

Conclusion


BioResolve Peptide C18 RP columns with MaxPeak Premier HPS technology provide clear analytical advantages for acidic and phosphorylated peptides in capillary and microflow LC–MS. The HPS-treated hardware yields higher recovery and superior peak shape from the first injection, reduces conditioning needs, and generates cleaner mass spectra compared to stainless-steel and several competitor columns. These characteristics improve throughput, quantitation and overall data quality in proteomics pipelines and related analytical workflows.

References


  1. Hanna CM, Koza SM, Addepalli B. Enhanced Recovery and Peak Shape of Acidic Peptides with BioResolve 1 mm ID Columns with MaxPeak Premier Technology. Waters Application Note 720009231, 2026.
  2. Hanna CM, Koza SM, Addepalli B. Benchmarking Resolution and Recovery of BioResolve 1 mm ID C18 RP Columns with MaxPeak Premier Technology. Waters Application Note 720009274, 2026.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Enhanced Recovery and Peak Shape of Acidic Peptides with BioResolve™ 1 mm ID Columns with MaxPeak™ Premier Technology
Application Note Enhanced Recovery and Peak Shape of Acidic Peptides with BioResolve™ 1 mm ID Columns with MaxPeak™ Premier Technology Caitlin M. Hanna, Stephan M. Koza, Balasubrahmanyam Addepalli Waters Corporation, United States Published on February 16, 2026 Abstract Microflow chromatography…
Key words
premier, premiertechnology, technologymicroflow, microflowmaxpeak, maxpeakshape, shapepeak, peakcolumns, columnsacidic, acidicpeptides, peptidesrecovery, recoveryhps, hpsprivacy, privacyproteomics, proteomicscolumn, columnfavored
Robust Capillary and Low-Microflow LC-MS with Improved Acidic Peptide Recovery Using BioResolve™ 300 μm ID Columns
Application Note Robust Capillary and Low-Microflow LC-MS with Improved Acidic Peptide Recovery Using BioResolve™ 300 µm ID Columns Caitlin M. Hanna, Stephan M. Koza, Balasubrahmanyam Addepalli Waters Corporation, United States Published on June 01, 2026 Abstract In this application note,…
Key words
columns, columnstenth, tenthmaxpeak, maxpeakpremier, premieracidic, acidicstainless, stainlessmicroflow, microflowregion, regionsteel, steelfirst, firstpeptide, peptidecolumn, columnhladlpsk, hladlpsklnqllr, lnqllrnvplyk
Benchmarking Resolution and Recovery of BioResolve™ 1 mm ID C18 RP Columns with MaxPeak™ Premier Technology
Application Note Benchmarking Resolution and Recovery of BioResolve™ 1 mm ID C18 RP Columns with MaxPeak™ Premier Technology Caitlin M. Hanna, Stephan M. Koza, Balasubrahmanyam Addepalli Waters Corporation, United States Published on March 11, 2026 Abstract The BioResolve Peptide C18…
Key words
technology, technologypremier, premieracidic, acidicrecovery, recoverypeptide, peptidemaxpeak, maxpeakshape, shapehladpsk, hladpskvnqigptlsepsik, vnqigptlsepsikieeelgdnavfagenfhhgdkl, ieeelgdnavfagenfhhgdklnvplpyk, nvplpykphosphorlyated, phosphorlyatedieeelgdnavfagenfhhgdk, ieeelgdnavfagenfhhgdkvnqigptlsesik, vnqigptlsesikprivacy
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology
Improving Chromatographic Separations Of Biopharmaceuticals With MaxPeak High Performance Surfaces (HPS) Technology Analytical Solutions Using MaxPeak High Performance Surfaces (HPS) Technology for Biopharmaceutical Therapeutics Biopharmaceutical therapeutics have consistently been the fastest growing segment within the pharmaceutical space and require advances…
Key words
premier, premieracquity, acquityglycan, glycanmaxpeak, maxpeaknucleotide, nucleotideculture, culturepeptide, peptidehps, hpsintact, intactbioaccord, bioaccordsystem, systemcolumn, columnprotein, proteinread, readglycans
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike