Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites
Applications | 2017 | Agilent TechnologiesInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, 2D-LC
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordsconjugated, antibody, rplc, mmae, conjugation, brentuximab, drug, peptides, intrachain, adcetris, scdk, herceptin, kadcyla, interchain, payload, dimension, modulation, linker, protease, peptide, adcs, monoclonal, sites, conjugates, cysteine, trastuzumab, cleavable, residues, sequence, gradient, characterization, second, mab, collision, dimensional, eight, flight, ions, case, reduction, two, promising, groups, digests, obtained, intense, more, mabs, overruled, tprvtcvvvdvshedpevkfnwyvdgvevhnak
Similar PDF
Analysis of Cysteine-Linked Antibody Drug Conjugates
2017|Agilent Technologies|Applications
Analysis of Cysteine-Linked Antibody Drug Conjugates Using Hydrophobic Interaction Chromatography on the Agilent 1260 Infinity II Bio-inert LC Application Note Biologics and Biosimilars Author Abstract Sonja Schneider Hydrophobic interaction chromatography (HIC) is frequently used for the Agilent Technologies, Inc. determination…
Key words
brentuximab, brentuximabvedotin, vedotindar, darhic, hicdrug, drugantibody, antibodyhydrophobic, hydrophobicmmae, mmaeadcs, adcsadc, adctige, tigeinteraction, interactionmab, mablinked, linkedcysteine
Characterization of Antibody‑Drug Conjugates Using 2D-LC and Native MS
2021|Agilent Technologies|Applications
Application Note Biopharma/Pharma Characterization of Antibody‑Drug Conjugates Using 2D-LC and Native MS Authors David L. Wong and Sarah M. Stow Agilent Technologies, Inc. Abstract Antibody drug conjugates (ADCs), which comprise a monoclonal antibody (mAb) conjugated to a small molecule drug…
Key words
dimension, dimensiondar, daradcs, adcsadc, adcsecond, secondnative, nativehic, hicadvancebio, advancebiocounts, countsmab, mabdeconvoluted, deconvoluteddrug, drugfirst, firstconjugated, conjugatedintact
Mapping the Drug Conjugation Sites of an Antibody-Drug Conjugate
2015|Agilent Technologies|Applications
Mapping the Drug Conjugation Sites of an Antibody-Drug Conjugate Using Automated Sample Preparation and LC/MS Analysis Application Note Authors Introduction Jing Chen Antibody drug conjugates (ADCs) that combine the specificity of monoclonal antibodies (mAbs) with the potency of cytotoxic molecules…
Key words
heavy, heavydrug, drugconjugation, conjugationlight, lightcounts, countsconjugated, conjugatedsite, sitesites, siteswere, werepeptides, peptidesherceptin, herceptinassaymap, assaymapacquisition, acquisitionsequence, sequencebioconfirm
Analysis of Tryptic Digests of a Monoclonal Antibody and an Antibody-Drug Conjugate with the Agilent 1290 Infinity II LC
2016|Agilent Technologies|Applications
Analysis of Tryptic Digests of a Monoclonal Antibody and an Antibody-Drug Conjugate with the Agilent 1290 Infinity II LC Application Note Biopharmaceuticals and Biosimilars Authors Abstract Gerd Vanhoenacker, Mieke Steenbeke, An Agilent 1290 Infinity II LC in combination with an…
Key words
kadcyla, kadcylamau, mauherceptin, herceptintryptic, trypticdigests, digestsmin, minpeptide, peptideantibody, antibodycapacity, capacitydelay, delaygradient, gradientdrug, drugmab, mabmixing, mixingpeak