Mapping the Drug Conjugation Sites of an Antibody-Drug Conjugate
Applications | 2015 | Agilent TechnologiesInstrumentation
Sample Preparation, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordsheavy, drug, conjugation, light, counts, conjugated, site, sites, were, peptides, herceptin, assaymap, acquisition, bioconfirm, sequence, digestion, stsggtaalgclvk, identified, loc, chain, trypsin, seq, automated, agilent, deck, mapping, min, modifications, antibody, bravo, time, latter, using, adc, mode, representative, peptide, ion, aedtav, algclvk, apgk, apklliysasflysgvpsr, dvntavaw, fflysk, fpepv, gfypsdiavewesngqpennykttppvldsdgs, kvqwk, lvesggglvq, mnslr, mtq
Similar PDF
Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites
2017|Agilent Technologies|Applications
Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites Using the Agilent 1290 Infinity II 2D-LC Solution Combined with the Agilent 6530 Quadrupole Time-of-Flight LC/MS System Application Note Biopharmaceuticals Authors Abstract Koen Sandra, Gerd Vanhoenacker, Antibody-drug conjugates (ADCs) are a promising…
Key words
conjugated, conjugatedantibody, antibodyrplc, rplcmmae, mmaeconjugation, conjugationbrentuximab, brentuximabdrug, drugpeptides, peptidesadcetris, adcetrisintrachain, intrachainscdk, scdkherceptin, herceptinkadcyla, kadcylainterchain, interchainpayload
Complete characterization of a lysine-linked antibody drug conjugate by native LC/MS intact mass analysis and peptide mapping
2017|Thermo Fisher Scientific|Applications
APPLICATION NOTE 72511 Complete characterization of a lysine-linked antibody drug conjugate by native LC/MS intact mass analysis and peptide mapping Authors Aaron O. Bailey,1 Stephane Houel,1 Kai Scheffler,2 Eugen Damoc,3 Jennifer Sutton,1 Jonathan L. Josephs1 Thermo Fisher Scientific 1 San…
Key words
chain, chainheavy, heavypeptide, peptideadc, adcmass, massintact, intactnative, nativesetting, settingmapping, mappingconjugation, conjugationdrug, drugemtansine, emtansinelinker, linkerantibody, antibodylysine
Characterization of Monoclonal Antibodies and ADCs using a Benchtop Orbitrap Mass Spectrometer
2015|Thermo Fisher Scientific|Posters
experiments were performed yielding 100% sequence coverage, site specific information of the drug-conjugate as well as expected and unexpected modifications. 10 21 0 Methods Sample Preparation M N LC Poster Note 643 97 The T-DM1 sample was reduced by DTT…
Key words
intact, intactabundance, abundancepeptide, peptidefigure, figurerelative, relativemolecule, moleculelight, lightadcs, adcsmass, massweight, weightmapping, mappingpepfinder, pepfinderheavy, heavyglycoforms, glycoformsthermo
An Integrated Workflow for Automated Calculation of Antibody‑Drug Conjugate (ADC) Drug‑to-Antibody Ratio (DAR)
2016|Agilent Technologies|Applications
An Integrated Workflow for Automated Calculation of Antibody‑Drug Conjugate (ADC) Drug‑to-Antibody Ratio (DAR) Using Automated Sample Preparation, Agilent MassHunter Walkup, and Agilent MassHunter BioConfirm DAR Calculator Software Application Note Biotherapeutics and Biosimilars Authors Abstract David L. Wong, Tanner Stevenson, and…
Key words
dar, daradc, adcdeconvoluted, deconvoluteddeglycosylated, deglycosylatedintact, intactreduced, reducedadcs, adcsantibody, antibodybioconfirm, bioconfirmdrug, drugassaymap, assaymapglycosylated, glycosylatedbravo, bravocalculator, calculatorcounts