Identifying Monoclonal Antibody Mutation Sites Using the Agilent 1290 Infinity II 2D-LC Solution with Q-TOF LC/MS

Applications | 2017 | Agilent TechnologiesInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, 2D-LC
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the Topic


Monoclonal antibodies are central to modern biopharmaceuticals but their large size and heterogeneity demand advanced analytical techniques to ensure safety and efficacy. Patent expirations and regulatory requirements drive the development of biosimilars, which must match originator products in amino acid sequence and structure. Two dimensional liquid chromatography coupled with high resolution mass spectrometry offers the resolving power needed to detect subtle sequence variants.

Objectives and Study Overview


This study aims to compare an infliximab originator with a candidate biosimilar by applying the Agilent 1290 Infinity II two dimensional liquid chromatography solution in combination with quadrupole time of flight LCMS. The goal is to identify any mutations or sequence differences that could affect biosimilarity.

Methodology


Sample preparation involved reduction of disulfide bonds, alkylation of cysteines, and tryptic digestion. Middle up analysis employed reversed phase LC on a C4 column with UV detection and accurate mass MS. Peptide mapping was performed using two orthogonal two dimensional methods: reversed phase×reversed phase at different pH values and strong cation exchange×reversed phase, both with heart cutting and modulation. Data dependent MSMS was acquired on the fly to confirm sequence changes.

Instrumentation


  • Agilent 1290 Infinity II High Speed Pumps
  • Agilent 1290 Infinity II Multisampler and Multicolumn Thermostat
  • Agilent 1290 Infinity II Diode Array Detector
  • Agilent 6530 and 6540 Quadrupole Time of Flight LCMS systems
  • Agilent OpenLab CDS and MassHunter software
  • GC Image LC×LC Edition Software

Key Results and Discussion


Middle up RPLCMS revealed a 99 Da mass increase on the heavy chain of the biosimilar, corresponding to a shift in glycoforms. RPLC×RPLC peptide maps showed disappearance of heavy chain peptides SLSLSPG and SLSLSPGK, replaced by SLSLSPGI, indicating a lysine to isoleucine substitution (+113 Da) and a threonine to serine replacement (−14 Da) at another site. SCX×RPLC mapping confirmed altered chromatographic behavior due to net charge differences. On‐the‐fly MSMS and RT PCR sequencing validated two point mutations (ACC to AGC and AAA to AUA), explaining the observed mass shifts.

Benefits and Practical Applications


This integrated 2D LCMS platform offers high resolution and orthogonality to detect even single amino acid substitutions in monoclonal antibodies. It supports biosimilar development, clone selection, and quality control by ensuring sequence integrity and comparability with originators.

Future Trends and Applications


Ongoing advancements may include faster modulation, novel separation chemistries, and automated data interpretation using machine learning. Expanded applications to other complex biologics and integration with real time process monitoring are anticipated.

Conclusion


The Agilent 1290 Infinity II 2D LC solution with QTOF MS proved effective in detecting and characterizing point mutations in a candidate infliximab biosimilar. This approach enhances analytical confidence in biopharmaceutical comparability assessments.

References


  1. Sandra K et al Modern chromatographic and mass spectrometric techniques for protein biopharmaceutical characterization J Chromatogr A 2014 1335 81–103
  2. Fekete S Guillarme D Sandra P Sandra K Chromatographic electrophoretic and mass spectrometric methods for the analytical characterization of protein biopharmaceuticals Anal Chem 2016 88 480–507
  3. Walsh G Biopharmaceutical benchmarks 2014 Nat Biotechnol 2014 32 992–1000
  4. Beck A Reichert JM Approval of the first biosimilar antibodies in Europe a major landmark for the biopharmaceutical industry mAbs 2013 5 621–623
  5. Sandra K Sandra P The opportunities of 2D LC in the analysis of monoclonal antibodies Bioanalysis 2015 7 2843–2847
  6. Stoll DR et al Direct identification of rituximab main isoforms and subunit analysis by online selective comprehensive two dimensional liquid chromatography–mass spectrometry Anal Chem 2015 87 8307–8315
  7. Sandra K et al Multiple heart cutting and comprehensive two dimensional liquid chromatography hyphenated to mass spectrometry for the characterization of the antibody drug conjugate ado trastuzumab emtansine J Chromatogr B 2016 1032 119–130
  8. Vanhoenacker G et al Comprehensive two dimensional liquid chromatography of therapeutic monoclonal antibody digests Anal Bioanal Chem 2015 407 355–366
  9. Vanhoenacker G Sandra K Vandenheede I David F Sandra P Huber U Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D LC Solution Part 2 HILICxRPLC MS Agilent Technologies Application Note 5991-4530EN 2014
  10. Vanhoenacker G Sandra K Vandenheede I David F Sandra P Huber U Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D LC Solution Part 1 2D Methods Agilent Technologies Application Note 5991-2880EN 2013

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Automated Switching between Peptide and Glycan Mapping with the Agilent 1290 Infinity II LC System
Application Note Biopharma/Pharma Automated Switching between Peptide and Glycan Mapping with the Agilent 1290 Infinity II LC System Increased productivity and flexibility in the characterization of monoclonal antibodies Authors Gerd Vanhoenacker, Aurélie Terrier, Gianni Vandenborre, Pat Sandra, and Koen Sandra…
Key words
glycan, glycanpeptide, peptideoriginator, originatortrastuzumab, trastuzumabmapping, mappingcounts, countsbiosimilar, biosimilaracquisition, acquisitionadvancebio, advancebioresponse, responseunits, unitsfld, fldinstantpc, instantpccho, chorituximab
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Application Note Biotherapeutics & Biosimilars Authors Abstract Gerd Vanhoenacker, Koen Sandra, Protein biopharmaceuticals such as monoclonal antibodies and recombinant Isabel Vandenheede, Frank David, and proteins are currently in…
Key words
ter, termodulation, modulationmonoclonal, monoclonalrecombinant, recombinantoxidation, oxidationorthogonality, orthogonalitystressed, stressedprotein, proteinspots, spotsgradient, gradienttrastuzumabs, trastuzumabsstress, stresssolvent, solventdstysstltlsk, dstysstltlskevqlvesggglvqpggslrlscaasgfn
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Part 2: HILIC × RPLC-MS
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Part 2: HILIC × RPLC-MS Application Note Biotherapeutics & Biosimilars Authors Abstract Gerd Vanhoenacker1, Koen Sandra1,2 , Trastuzumab (marketed as Herceptin), is a monoclonal antibody used in the…
Key words
dimension, dimensionnonstressed, nonstressedsecond, secondtrastuzumab, trastuzumabhilic, hilicter, terrplc, rplcfirst, firstoxidation, oxidationmodulation, modulationflow, flowstressed, stressedhydrophilic, hydrophilicmonoclonal, monoclonalcomprehensive
LC/MS/MS Peptide Mapping Comparison of Innovator and Biosimilars of Rituximab
Application Note Biotherapeutics and Biosimilars LC/MS/MS Peptide Mapping Comparison of Innovator and Biosimilars of Rituximab Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract The development and manufacturing of biosimilars require comparability studies with innovator biotherapeutic products. This Application Note presents…
Key words
innovator, innovatorpeptide, peptidecounts, countschain, chainmapping, mappingbiosimilar, biosimilarcharge, chargeunmodified, unmodifiedptms, ptmsheavy, heavyassaymap, assaymapttppvldsdgsfflyskl, ttppvldsdgsfflysklbiosimilars, biosimilarsmabs, mabsbravo
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike