Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Part 2: HILIC × RPLC-MS
Applications | 2014 | Agilent TechnologiesInstrumentation
High resolution peptide mapping is vital for in-depth characterization of monoclonal antibodies like trastuzumab. Complex tryptic digests yield >100 peptides, requiring enhanced peak capacity to detect modifications and impurities in biotherapeutic analysis.
The application note demonstrates an online comprehensive two-dimensional LC (LC×LC) combining HILIC and reversed-phase LC (RPLC) using the Agilent 1290 Infinity 2D-LC Solution coupled to a 6530 Q-TOF MS. Key goals include improving separation orthogonality, peak capacity, and reliable identification of peptide modifications under stress conditions.
Sample Preparation:
The LC×LC contour map resolved over 60 identity peptides, revealing orthogonal retention of peptides. MS total ion chromatograms enabled precise mass identification (<5 ppm) of modifications such as methionine oxidation and asparagine deamidation. HILIC separation isolated deamidated peptides indistinguishable in RPLC, demonstrating enhanced impurity detection.
Advances may include integration of additional separation modalities (e.g., ion exchange), automation of 2D-LC methods, and deeper proteoform mapping. Coupling with advanced data analytics and machine learning can further enhance characterization of biotherapeutics.
The Agilent 1290 Infinity 2D-LC Solution combined with Q-TOF MS provides a robust platform for detailed peptide mapping of monoclonal antibodies. HILIC×RPLC–MS offers improved orthogonality and sensitivity for detecting degradation products and modifications, supporting quality control in biopharmaceutical development.
2D-LC
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Importance of the Topic
High resolution peptide mapping is vital for in-depth characterization of monoclonal antibodies like trastuzumab. Complex tryptic digests yield >100 peptides, requiring enhanced peak capacity to detect modifications and impurities in biotherapeutic analysis.
Study Objectives and Overview
The application note demonstrates an online comprehensive two-dimensional LC (LC×LC) combining HILIC and reversed-phase LC (RPLC) using the Agilent 1290 Infinity 2D-LC Solution coupled to a 6530 Q-TOF MS. Key goals include improving separation orthogonality, peak capacity, and reliable identification of peptide modifications under stress conditions.
Methodology and Instrumentation
Sample Preparation:
- Tryptic digestion of trastuzumab with reduction, alkylation, and cleanup.
- Forced degradation: oxidation (tert-butyl hydroperoxide) and pH stress.
- First dimension: HILIC column (ZORBAX RRHD 300-HILIC, 2.1×100 mm, 1.8 μm), gradient of ammonium formate/acetonitrile at 50 μL/min, 30 °C.
- Second dimension: RPLC column (ZORBAX Eclipse Plus C18, 4.6×50 mm, 3.5 μm), high-speed gradient at 4 mL/min, 30 °C.
- Modulation: 0.45 min cycle with dual 40 μL loops, selective transfer (12–69 min).
- MS detection: Agilent 6530 Accurate-Mass Q-TOF, positive ESI, Jet Stream, high resolution (10,000 at m/z 1000).
Main Results and Discussion
The LC×LC contour map resolved over 60 identity peptides, revealing orthogonal retention of peptides. MS total ion chromatograms enabled precise mass identification (<5 ppm) of modifications such as methionine oxidation and asparagine deamidation. HILIC separation isolated deamidated peptides indistinguishable in RPLC, demonstrating enhanced impurity detection.
Benefits and Practical Applications
- High peak capacity and orthogonal selectivity for complex digest analysis.
- Comprehensive detection of low-level modifications and impurities.
- Online 2D-LC workflow improves throughput compared to offline methods.
Future Trends and Applications
Advances may include integration of additional separation modalities (e.g., ion exchange), automation of 2D-LC methods, and deeper proteoform mapping. Coupling with advanced data analytics and machine learning can further enhance characterization of biotherapeutics.
Conclusion
The Agilent 1290 Infinity 2D-LC Solution combined with Q-TOF MS provides a robust platform for detailed peptide mapping of monoclonal antibodies. HILIC×RPLC–MS offers improved orthogonality and sensitivity for detecting degradation products and modifications, supporting quality control in biopharmaceutical development.
Reference
- Sandra K. et al. LCGC Europe 2013.
- François I. et al. Anal. Chim. Acta 2009.
- Sandra K. et al. J. Chromatogr. B 2009.
- Zhu A. et al. Agilent Application Note 2013.
- D’Attoma A. & Heinisch S. J. Chromatogr. A 2013.
- Vanhoenacker G. et al. Agilent Application Note 2013.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution
2017|Agilent Technologies|Applications
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Application Note Biotherapeutics & Biosimilars Authors Abstract Gerd Vanhoenacker, Koen Sandra, Protein biopharmaceuticals such as monoclonal antibodies and recombinant Isabel Vandenheede, Frank David, and proteins are currently in…
Key words
ter, termodulation, modulationmonoclonal, monoclonalrecombinant, recombinantoxidation, oxidationorthogonality, orthogonalitystressed, stressedprotein, proteinspots, spotsgradient, gradienttrastuzumabs, trastuzumabsstress, stresssolvent, solventdstysstltlsk, dstysstltlskevqlvesggglvqpggslrlscaasgfn
Identifying Monoclonal Antibody Mutation Sites Using the Agilent 1290 Infinity II 2D-LC Solution with Q-TOF LC/MS
2017|Agilent Technologies|Applications
Identifying Monoclonal Antibody Mutation Sites Using the Agilent 1290 Infinity II 2D-LC Solution with Q-TOF LC/MS Application Note Biopharmaceuticals and Biosimilars Authors Abstract Koen Sandra, Gerd Vanhoenacker, In recent years, 2D-LC has been highly promising for the detailed characterization Mieke…
Key words
infliximab, infliximabbiosimilar, biosimilaroriginator, originatorrplc, rplcslslspgk, slslspgkslslspg, slslspgydywgqgttltvssastk, ydywgqgttltvssastkcandidate, candidatenyygstydywgqgttltvssastk, nyygstydywgqgttltvssastkbiosimilars, biosimilarspeptide, peptidedimensional, dimensionaldimension, dimensionmutations, mutationsheavy
Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites
2017|Agilent Technologies|Applications
Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites Using the Agilent 1290 Infinity II 2D-LC Solution Combined with the Agilent 6530 Quadrupole Time-of-Flight LC/MS System Application Note Biopharmaceuticals Authors Abstract Koen Sandra, Gerd Vanhoenacker, Antibody-drug conjugates (ADCs) are a promising…
Key words
conjugated, conjugatedantibody, antibodyrplc, rplcmmae, mmaeconjugation, conjugationbrentuximab, brentuximabdrug, drugpeptides, peptidesherceptin, herceptinadcetris, adcetrisscdk, scdkintrachain, intrachainkadcyla, kadcylainterchain, interchaindimension
Agilent 1290 Infinity II 2D-LC solution Biopharmaceutical Polymer Analysis
2017|Agilent Technologies|Presentations
Agilent 1290 Infinity II 2D-LC Solution Biopharmaceutical Polymer Analysis WCBP Jan 2017 Washington, DC 1 Overview • Resolving power and how to measure it • Why two-dimensional LC? • Setup of a 2D-LC System • Different modes of 2D-LC •…
Key words
dimension, dimensionheart, heartwcx, wcxcutting, cuttingcharged, chargedhilic, hilicwax, waxcharge, chargeinnovator, innovatormultiple, multipleanalysis, analysiscuts, cutstiter, titerpeak, peakmonoclonal