Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Part 2: HILIC × RPLC-MS

Applications | 2014 | Agilent TechnologiesInstrumentation
2D-LC
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Importance of the Topic


High resolution peptide mapping is vital for in-depth characterization of monoclonal antibodies like trastuzumab. Complex tryptic digests yield >100 peptides, requiring enhanced peak capacity to detect modifications and impurities in biotherapeutic analysis.

Study Objectives and Overview


The application note demonstrates an online comprehensive two-dimensional LC (LC×LC) combining HILIC and reversed-phase LC (RPLC) using the Agilent 1290 Infinity 2D-LC Solution coupled to a 6530 Q-TOF MS. Key goals include improving separation orthogonality, peak capacity, and reliable identification of peptide modifications under stress conditions.

Methodology and Instrumentation


Sample Preparation:
  • Tryptic digestion of trastuzumab with reduction, alkylation, and cleanup.
  • Forced degradation: oxidation (tert-butyl hydroperoxide) and pH stress.
Chromatographic Setup:
  • First dimension: HILIC column (ZORBAX RRHD 300-HILIC, 2.1×100 mm, 1.8 μm), gradient of ammonium formate/acetonitrile at 50 μL/min, 30 °C.
  • Second dimension: RPLC column (ZORBAX Eclipse Plus C18, 4.6×50 mm, 3.5 μm), high-speed gradient at 4 mL/min, 30 °C.
  • Modulation: 0.45 min cycle with dual 40 μL loops, selective transfer (12–69 min).
  • MS detection: Agilent 6530 Accurate-Mass Q-TOF, positive ESI, Jet Stream, high resolution (10,000 at m/z 1000).

Main Results and Discussion


The LC×LC contour map resolved over 60 identity peptides, revealing orthogonal retention of peptides. MS total ion chromatograms enabled precise mass identification (<5 ppm) of modifications such as methionine oxidation and asparagine deamidation. HILIC separation isolated deamidated peptides indistinguishable in RPLC, demonstrating enhanced impurity detection.

Benefits and Practical Applications


  • High peak capacity and orthogonal selectivity for complex digest analysis.
  • Comprehensive detection of low-level modifications and impurities.
  • Online 2D-LC workflow improves throughput compared to offline methods.

Future Trends and Applications


Advances may include integration of additional separation modalities (e.g., ion exchange), automation of 2D-LC methods, and deeper proteoform mapping. Coupling with advanced data analytics and machine learning can further enhance characterization of biotherapeutics.

Conclusion


The Agilent 1290 Infinity 2D-LC Solution combined with Q-TOF MS provides a robust platform for detailed peptide mapping of monoclonal antibodies. HILIC×RPLC–MS offers improved orthogonality and sensitivity for detecting degradation products and modifications, supporting quality control in biopharmaceutical development.

Reference


  • Sandra K. et al. LCGC Europe 2013.
  • François I. et al. Anal. Chim. Acta 2009.
  • Sandra K. et al. J. Chromatogr. B 2009.
  • Zhu A. et al. Agilent Application Note 2013.
  • D’Attoma A. & Heinisch S. J. Chromatogr. A 2013.
  • Vanhoenacker G. et al. Agilent Application Note 2013.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Application Note Biotherapeutics & Biosimilars Authors Abstract Gerd Vanhoenacker, Koen Sandra, Protein biopharmaceuticals such as monoclonal antibodies and recombinant Isabel Vandenheede, Frank David, and proteins are currently in…
Key words
ter, termodulation, modulationmonoclonal, monoclonalrecombinant, recombinantoxidation, oxidationorthogonality, orthogonalitystressed, stressedprotein, proteinspots, spotsgradient, gradienttrastuzumabs, trastuzumabsstress, stresssolvent, solventdstysstltlsk, dstysstltlskevqlvesggglvqpggslrlscaasgfn
Identifying Monoclonal Antibody Mutation Sites Using the Agilent 1290 Infinity II 2D-LC Solution with Q-TOF LC/MS
Identifying Monoclonal Antibody Mutation Sites Using the Agilent 1290 Infinity II 2D-LC Solution with Q-TOF LC/MS Application Note Biopharmaceuticals and Biosimilars Authors Abstract Koen Sandra, Gerd Vanhoenacker, In recent years, 2D-LC has been highly promising for the detailed characterization Mieke…
Key words
infliximab, infliximabbiosimilar, biosimilaroriginator, originatorrplc, rplcslslspgk, slslspgkslslspg, slslspgydywgqgttltvssastk, ydywgqgttltvssastkcandidate, candidatenyygstydywgqgttltvssastk, nyygstydywgqgttltvssastkbiosimilars, biosimilarspeptide, peptidedimensional, dimensionaldimension, dimensionmutations, mutationsheavy
Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites
Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites Using the Agilent 1290 Infinity II 2D-LC Solution Combined with the Agilent 6530 Quadrupole Time-of-Flight LC/MS System Application Note Biopharmaceuticals Authors Abstract Koen Sandra, Gerd Vanhoenacker, Antibody-drug conjugates (ADCs) are a promising…
Key words
conjugated, conjugatedantibody, antibodyrplc, rplcmmae, mmaeconjugation, conjugationbrentuximab, brentuximabdrug, drugpeptides, peptidesherceptin, herceptinadcetris, adcetrisscdk, scdkintrachain, intrachainkadcyla, kadcylainterchain, interchaindimension
Agilent 1290 Infinity II 2D-LC solution Biopharmaceutical Polymer Analysis
Agilent 1290 Infinity II 2D-LC Solution Biopharmaceutical Polymer Analysis WCBP Jan 2017 Washington, DC 1 Overview • Resolving power and how to measure it • Why two-dimensional LC? • Setup of a 2D-LC System • Different modes of 2D-LC •…
Key words
dimension, dimensionheart, heartwcx, wcxcutting, cuttingcharged, chargedhilic, hilicwax, waxcharge, chargeinnovator, innovatormultiple, multipleanalysis, analysiscuts, cutstiter, titerpeak, peakmonoclonal
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike