Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution
Applications | 2017 | Agilent TechnologiesInstrumentation
2D-LC
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordster, modulation, monoclonal, recombinant, oxidation, orthogonality, protein, stressed, spots, gradient, stress, trastuzumabs, solvent, method, adyek, dstysstltlsk, evqlvesggglvqpggslrlscaasgfn, eyk, fsgsr, ikdtyihwvrqapgkglew, nykttppvldsdgsfflyskltvdksrw, qqgnvfscsvmhealhnhytqkslslspg, sfnr, yadsvk, gqpr, indicating, apk, dyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntk, qapgk, vqwk, aspecific, eemtk, ltvdk, vtitcr, antibodies, gec, veik, vepk, identity, metablys, vdk, rate, good, lliysasflysgvpsr, scdk, tkpr, vsnk, first, aedtavyycsr, diqmtqspsslsasvgdr
Similar PDF
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Part 2: HILIC × RPLC-MS
2014|Agilent Technologies|Applications
Analysis of Monoclonal Antibody Digests with the Agilent 1290 Infinity 2D-LC Solution Part 2: HILIC × RPLC-MS Application Note Biotherapeutics & Biosimilars Authors Abstract Gerd Vanhoenacker1, Koen Sandra1,2 , Trastuzumab (marketed as Herceptin), is a monoclonal antibody used in the…
Key words
dimension, dimensionnonstressed, nonstressedsecond, secondtrastuzumab, trastuzumabhilic, hilicter, terrplc, rplcfirst, firstoxidation, oxidationflow, flowmodulation, modulationstressed, stressedhydrophilic, hydrophilicmonoclonal, monoclonalcomprehensive
Identifying Monoclonal Antibody Mutation Sites Using the Agilent 1290 Infinity II 2D-LC Solution with Q-TOF LC/MS
2017|Agilent Technologies|Applications
Identifying Monoclonal Antibody Mutation Sites Using the Agilent 1290 Infinity II 2D-LC Solution with Q-TOF LC/MS Application Note Biopharmaceuticals and Biosimilars Authors Abstract Koen Sandra, Gerd Vanhoenacker, In recent years, 2D-LC has been highly promising for the detailed characterization Mieke…
Key words
infliximab, infliximabbiosimilar, biosimilaroriginator, originatorrplc, rplcslslspgk, slslspgkslslspg, slslspgydywgqgttltvssastk, ydywgqgttltvssastkcandidate, candidatenyygstydywgqgttltvssastk, nyygstydywgqgttltvssastkbiosimilars, biosimilarspeptide, peptidedimension, dimensiondimensional, dimensionalmutations, mutationsheavy
Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites
2017|Agilent Technologies|Applications
Characterizing Antibody-Drug Conjugates and Assigning Drug Conjugation Sites Using the Agilent 1290 Infinity II 2D-LC Solution Combined with the Agilent 6530 Quadrupole Time-of-Flight LC/MS System Application Note Biopharmaceuticals Authors Abstract Koen Sandra, Gerd Vanhoenacker, Antibody-drug conjugates (ADCs) are a promising…
Key words
conjugated, conjugatedantibody, antibodyrplc, rplcmmae, mmaeconjugation, conjugationbrentuximab, brentuximabdrug, drugpeptides, peptidesintrachain, intrachainherceptin, herceptinadcetris, adcetrisscdk, scdkkadcyla, kadcylainterchain, interchainpayload
Fully Automated Characterization of Monoclonal Antibody Charge Variants Using 4D-LC/MS
2020|Agilent Technologies|Applications
Application Note Pharma & Biopharma Fully Automated Characterization of Monoclonal Antibody Charge Variants Using 4D-LC/MS D CEX (DAD) 1 Online 2 D Desalting/Reduction 3 D Digestion 4 D Peptide mapping (MS) Authors Liesa Verscheure, Gerd Vanhoenacker, Pat Sandra, and Koen…
Key words
cex, cexmapping, mappingcounts, countspeptide, peptidedesalting, desaltingdigestion, digestionpeak, peakvariants, variantscharacterization, characterizationmin, mintrypsin, trypsincharge, chargedimensional, dimensionalphase, phasemobile