Relative Quantification of TMT-labeled, cross-linked proteins using XlinkX node in Proteome Discoverer
Posters | 2018 | Thermo Fisher Scientific | ASMSInstrumentation
The structural organization and dynamic interactions of protein complexes underpin many cellular processes. Quantitative cross-linking mass spectrometry (QXL-MS) bridges structural biology and proteomics by capturing residue‐level proximity information in a multiplexed fashion. Implementing robust, high‐throughput workflows for isobaric‐tagged crosslinked peptides significantly enhances our capability to monitor conformational changes and protein–protein interactions under varying conditions.
This work presents a complete analytical pipeline in Thermo Scientific™ Proteome Discoverer™ 2.3 for simultaneous identification and multiplexed quantification of DSSO‐crosslinked peptides labeled with tandem mass tags (TMT). The study demonstrates method validation using a Cytochrome C digest standard and applies the workflow to probe conformational shifts in the rabbit 20S proteasome upon activation by sodium dodecyl sulfate (SDS).
Sample preparation involved cross-linking model proteins (Cytochrome C and 20S proteasome) with DSSO at defined protein:crosslinker ratios, followed by enzymatic digestion, TMT labeling, and prefractionation via strong cation exchange and size‐exclusion chromatography. Peptides were separated by reversed‐phase UHPLC and analyzed on an Orbitrap Fusion Lumos tribrid mass spectrometer using a suite of hybrid acquisition methods (ID‐MS3, SPS‐MS3, combined MS3–SPS) to capture both identification and reporter‐ion quantification. Data processing used Proteome Discoverer 2.3 with the XlinkX 2.0 node for crosslinked spectrum matches (CSMs) and corrected reporter abundances for isotopic impurities.
Among tested acquisition schemes, the ID‐SPS‐MS3 approach delivered the best balance of identification depth and quantitative accuracy, yielding over 100 unique intra- and interprotein crosslinks. Validation with TMT2‐plex Cytochrome C mixtures confirmed linear quantification over a 1:1, 1:5, and 1:10 ratio range. Application to the rabbit 20S proteasome revealed SDS‐induced conformational rearrangements in the outer alpha ring, notably changes in crosslink distances between Lys254 and Lys199. Quantitative comparisons of monolinked versus unmodified peptides showed consistent abundances, underscoring method precision.
Looking ahead, extending multiplex capacity with higher‐plex TMT reagents, integrating machine learning for crosslink assignment, and combining QXL-MS data with cryo‐EM or molecular dynamics simulations will drive deeper insights into proteome‐scale structural dynamics. Automation of sample preparation and real‐time data processing will further increase throughput and reproducibility.
The described Proteome Discoverer 2.3 workflow with XlinkX 2.0 offers a validated, high‐precision strategy for relative quantification of TMT‐labeled crosslinked peptides. Its robust performance in model proteins and the rabbit 20S proteasome demonstrates its value for probing conformational changes and protein interactions at residue resolution.
Software, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Summary
Importance of the topic
The structural organization and dynamic interactions of protein complexes underpin many cellular processes. Quantitative cross-linking mass spectrometry (QXL-MS) bridges structural biology and proteomics by capturing residue‐level proximity information in a multiplexed fashion. Implementing robust, high‐throughput workflows for isobaric‐tagged crosslinked peptides significantly enhances our capability to monitor conformational changes and protein–protein interactions under varying conditions.
Objectives and study overview
This work presents a complete analytical pipeline in Thermo Scientific™ Proteome Discoverer™ 2.3 for simultaneous identification and multiplexed quantification of DSSO‐crosslinked peptides labeled with tandem mass tags (TMT). The study demonstrates method validation using a Cytochrome C digest standard and applies the workflow to probe conformational shifts in the rabbit 20S proteasome upon activation by sodium dodecyl sulfate (SDS).
Methodology and instrumentation
Sample preparation involved cross-linking model proteins (Cytochrome C and 20S proteasome) with DSSO at defined protein:crosslinker ratios, followed by enzymatic digestion, TMT labeling, and prefractionation via strong cation exchange and size‐exclusion chromatography. Peptides were separated by reversed‐phase UHPLC and analyzed on an Orbitrap Fusion Lumos tribrid mass spectrometer using a suite of hybrid acquisition methods (ID‐MS3, SPS‐MS3, combined MS3–SPS) to capture both identification and reporter‐ion quantification. Data processing used Proteome Discoverer 2.3 with the XlinkX 2.0 node for crosslinked spectrum matches (CSMs) and corrected reporter abundances for isotopic impurities.
Main results and discussion
Among tested acquisition schemes, the ID‐SPS‐MS3 approach delivered the best balance of identification depth and quantitative accuracy, yielding over 100 unique intra- and interprotein crosslinks. Validation with TMT2‐plex Cytochrome C mixtures confirmed linear quantification over a 1:1, 1:5, and 1:10 ratio range. Application to the rabbit 20S proteasome revealed SDS‐induced conformational rearrangements in the outer alpha ring, notably changes in crosslink distances between Lys254 and Lys199. Quantitative comparisons of monolinked versus unmodified peptides showed consistent abundances, underscoring method precision.
Benefits and practical applications
- Enables simultaneous mapping and quantification of crosslinked networks within protein complexes.
- Supports comparative structural analysis under varying biochemical conditions.
- Integrates seamlessly into existing proteomics pipelines using widely adopted software.
Future trends and applications
Looking ahead, extending multiplex capacity with higher‐plex TMT reagents, integrating machine learning for crosslink assignment, and combining QXL-MS data with cryo‐EM or molecular dynamics simulations will drive deeper insights into proteome‐scale structural dynamics. Automation of sample preparation and real‐time data processing will further increase throughput and reproducibility.
Conclusion
The described Proteome Discoverer 2.3 workflow with XlinkX 2.0 offers a validated, high‐precision strategy for relative quantification of TMT‐labeled crosslinked peptides. Its robust performance in model proteins and the rabbit 20S proteasome demonstrates its value for probing conformational changes and protein interactions at residue resolution.
Instrumentation used
- Thermo Scientific™ UltiMate™ 3000 UHPLC system with EASY‐Spray™ column
- Orbitrap Fusion Lumos Tribrid Mass Spectrometer
- Proteome Discoverer™ 2.3 software with XlinkX 2.0 node
References
- Yu C., Huszagh A., Viner R., Novitsky E.J., Rychnovsky S.D., Huang L. Developing a Multiplexed Quantitative Cross-linking Mass Spectrometry Platform for Comparative Structural Analysis of Protein Complexes. Anal. Chem. 2016;88(20):10301–10308.
- Combe C.W., Fischer L., Rappsilber J. xiNET: cross-link network maps with residue resolution. Mol. Cell. Proteomics. 2015;14(4):1137–1147.
- Shibatani T., Ward W.F. Sodium dodecyl sulfate (SDS) activation of the 20S proteasome in rat liver. Arch. Biochem. Biophys. 1995;321(1):160–166.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Crosslinking mass spectrometry (XL-MS) goes mainstream
2018|Thermo Fisher Scientific|Technical notes
proteomics WHITE PAPER 65343 Crosslinking mass spectrometry (XL-MS) goes mainstream Mass spectrometrists and structural biologists guide to using XL-MS to understand the structure and function of molecular machines Author Executive summary Julian Saba, Thermo Fisher Scientific, San Jose, CA, USA…
Key words
crosslinked, crosslinkedprotein, proteinpeptides, peptidescrosslinking, crosslinkingcrosslinkers, crosslinkersdsso, dssointeractions, interactionsmass, masspeptide, peptidecan, canions, ionscleavable, cleavableproteins, proteinscomplexes, complexesresearchers
Evaluation of FAIMS Technology for Mass Spec Analysis of Chemical Cross-linked Peptides
2019|Thermo Fisher Scientific|Posters
Evaluation of FAIMS Technology for Mass Spec Analysis of Chemical Cross-linked Peptides Rosa Viner1; Leigh A Foster2; Ryan D. Bomgarden2; Michael W. Belford1; Satendra Prasad1; Romain Huguet1; Eloy R. Wouters1 , 1Thermo Fisher Scientific, San Jose, CA; 2Rockford, IL ABSTRACT…
Key words
faims, faimsscx, scxpeptides, peptidescrosslinked, crosslinkeddss, dsscross, crossfractionation, fractionationlinked, linkedmass, massnce, ncemax, maxunmodified, unmodifiedpierce, piercesettings, settingshcd
Optimized quantitative XL-MS Analysis on an Orbitrap Tribrid Apex mass spectrometer
2026|Thermo Fisher Scientific|Posters
Crosslinking mass spectrometry Optimized quantitative XL-MS Analysis on an Orbitrap Tribrid Apex mass spectrometer Yi He, Nicolas Hartal, Graeme McAlister, Rafael Maleni, Weijing Liu Thermo Fisher Scientific, San Jose, CA Abstract Results Purpose: To optimize the quantitative XL-MS workflows with…
Key words
apex, apexorbitrap, orbitraptribrid, tribridirmpd, irmpdmass, massagc, agcxls, xlscrosslinking, crosslinkingnormalized, normalizedtmt, tmtspectrometer, spectrometermnsntiaskmgsfsqsdsvalhqrhqgvmvgmgqkdsyvgdeaqsk, mnsntiaskmgsfsqsdsvalhqrhqgvmvgmgqkdsyvgdeaqskcsms, csmstarget, targetisolation
IMSC: Optimization of crosslinked peptide analysis on an Orbitrap Fusion Lumos mass spectrometer
2016|Thermo Fisher Scientific|Posters
Thermo Scientific™ Proteome Discoverer™ using a XlinkX software node. Methods: Different amine-reactive, homobifuctional crosslinkers including disuccinimidyl Results: For both DSSO and BuUrBu, we identified over 40 BSA inter-crosslinked peptides 2 CID for DSSO. We also to less than(DSS), 20 using…
Key words
crosslinked, crosslinkedbuurbu, buurbucleavable, cleavablecrosslinkers, crosslinkersethcd, ethcddsso, dssopeptides, peptidesprotein, proteincrosslinking, crosslinkingidentified, identifiedxlinkx, xlinkxsequestht, sequesthtcid, cidlumos, lumosbsa