Mass Spectrometry Based Allergen Detection: Applicability of Published Peptide Sequences for the Quantification of Different Peanut Varieties and Processed Peanuts Using Triple Quadrupole LC/MS
Posters | 2013 | Agilent Technologies | RAFAInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesFood & Agriculture
ManufacturerAgilent Technologies
Key wordspeanut, runner, peanuts, bolivia, unknown, elisa, natal, processing, dependent, peptides, signal, roasting, allergen, varieties, seems, brazil, africa, ahpvainasselhllgfginaennhriflagdkdnvidqiekqak, bayo, dlafpgsgeqvekliknqkeshfvsarp, dqsqqqqdshqkvhrfnegdliavptgvafwlyndhdtdvvavsltdtnnndnqldqfprrfnlagnheqeflryqqqsrqsrrrslpyspyspqsqprqeerefsprgqhsrr, eragqeeeheggnifsgftpeflaqafqvddrqivqnlrgeneseeqgaivtvrgglrilspdrkrgadeeeeydedeyeydeedrrrgrgsrgsgngieetictatvkknigr, ianlagensvidnlpeevvansyglpreqarqlknnnpfkffvppsqqsprava, isfrqqpeenacqfqrlnaqrpdnrieseggyietwnpnnqefecagvalsrlvlrrnalrrpfysnapqeifiqqgrgyfglifpgcpstyeepaqqgrryqsqrpprrlqee, lregepdlsnnfgklfevkpdkknpqlqdldmmltxveikegalvlphfnskamvivvvnkgtgnlelvavrkeqqqrgrreeeededeeeegsnrevrrytarlkegdvfimpa, nrspdiynpqagslktanelnllilrwlglsaeygnlyrnalfvphyntnahsiiyalrgrahvqvvdsngnrvydeelqeghvlvvpqnfavagksqsdnfeyvafktdsrps, overo, srnnpfyfpsrrfstrygnqngrirvlqrfdqrsrqfqnlqnhrivqieakpntlvlpkhadadnilviqqgqatvtvangnnrksfnldeghalripsgfisyilnrhdnqnlr, vakismpvntpgqfedffpassrdqssylqgfsrntleaafnaefneirrvlleenaggeqeergqrrwstrssennegvivkvskehveeltkhaksvskkgseeegditnpin, variety, intensity, detection, intensities, reduced, south, sequences, usa, native, affected, based, published, food, especially, peptid, salted, virginia, processed, cultivar, peptide, colorado
Similar PDF
The Analysis of Allergens in Raw and Roasted Peanuts Using nanoACQUITY UPLC and Xevo Q-Tof MS
2010|Waters|Applications
The Analysis of Allergens in Raw and Roasted Peanuts Using nanoACQUITY UPLC and Xevo Q-Tof MS Hui Wei1, Antonietta Gledhill2, Soheila Maleki3 Waters Corporation, Beverly, MA, USA; 2Waters Corporation, Manchester, UK; 3USDA-ARS-SRRC, New Orleans, USA 1 A P P LIC…
Key words
roasted, roastednanoacquity, nanoacquitypeanuts, peanutsallergens, allergensxevo, xevoplgs, plgsraw, rawpeanut, peanutuplc, uplcpeptide, peptidetof, tofpeptides, peptidesallergenic, allergenicprotein, proteinusing
High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060]
2016|Shimadzu|Applications
LAAN-A-LM-E112 Application News Liquid Chromatography Mass Spectrometry High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060] C141 No. Food allergens are a major public health concern. Among them, peanut allergy is one of the common food allergies.…
Key words
peanut, peanutsurfactant, surfactanttransitions, transitionsallergen, allergenfile, filemrm, mrmthyme, thymenews, newspeanuts, peanutsmin, minchili, chiliblank, blankdigestion, digestionspiked, spikedsensitivity
High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060]
2016|Shimadzu|Applications
LAAN-A-LM-E112 Application News Liquid Chromatography Mass Spectrometry High Sensitivity Analysis of Peanut Allergen in Cumin and Spice Mix [LCMS-8060] C141 No. Food allergens are a major public health concern. Among them, peanut allergy is one of the common food allergies.…
Key words
peanut, peanutsurfactant, surfactanttransitions, transitionsallergen, allergenfile, filemrm, mrmthyme, thymenews, newspeanuts, peanutsmin, minchili, chiliblank, blankdigestion, digestionspiked, spikedsensitivity
LC/Q-TOF Marker Identification to TQ LC/MS Targeted Quantitation
2022|Agilent Technologies|Applications
Application Note Food Testing and Agriculture LC/Q-TOF Marker Identification to TQ LC/MS Targeted Quantitation Development and evaluation of sensitive and robust workflow for detecting peanut allergens in wheat flour Authors Yuwei Chang, Hong Peng, and Guangtao Zhang Mars Global Food…
Key words
hso, hsopeanut, peanutcwf, cwfdlafpgsgeqvek, dlafpgsgeqvekiflagdkdnvidqiek, iflagdkdnvidqiekelisa, elisanacl, naclpeptides, peptidespeptide, peptideallergens, allergensflour, flourwere, weretof, tofmethod, methodwheat