Monitoring the intact light chain of therapeutic monoclonal antibodies in human serum using an Orbitrap Exploris 240 mass spectrometer for clinical research
Applications | 2022 | Thermo Fisher ScientificInstrumentation
Monoclonal antibodies (mAbs) are increasingly used in clinical therapy, with a projected market value exceeding $200 billion by 2026. Precise quantitation of therapeutic mAbs in patient serum is critical for optimizing dosing, ensuring efficacy, and minimizing adverse effects. Traditional peptide-based assays can be time-consuming and may struggle to distinguish therapeutic mAbs from endogenous immunoglobulins.
This study presents a rapid and selective workflow for quantifying intact light chains of therapeutic mAbs in human serum. By employing Protein L magnetic bead capture, on‐bead IdeS digestion and disulfide reduction, and high‐resolution accurate mass (HRAM) Orbitrap analysis, the authors aimed to establish limits of detection (LOD) and quantitation (LOQ), linear range, and reproducibility for six clinically relevant mAbs.
Sample preparation involved spiking six target mAbs (adalimumab, bevacizumab, camrelizumab, daratumumab, golimumab, rituximab) at concentrations from 1 to 100 µg/mL into human serum. Two non‐overlapping mAbs (nivolumab, pembrolizumab) served as internal standards. Protein L magnetic beads selectively bound kappa light chain–containing antibodies, excluding lambda chains. Captured mAbs underwent on‐bead IdeS digestion at 37 °C and on‐bead reduction with TCEP at 57 °C, eliminating elution steps and minimizing sample loss. Following desalting and concentration, samples were analyzed by reversed-phase UHPLC coupled to an Orbitrap Exploris 240 MS under the BioPharma option.
High-resolution MS at >120 k resolving power enabled clear separation of isotopic clusters for light, heavy (Fd′), and Fc/2 subunits. Calibration curves for all six mAbs exhibited excellent linearity (R2>0.99). LOQs ranged from 1 to 5 µg/mL; LODs were between 1 and 5 µg/mL. Inter- and intra-day reproducibility yielded retention time variation <0.05 min within lots (<0.2 min between lots) and peak area differences <20% across columns.
This streamlined workflow requires only 10 µL of serum per analysis and under 1.5 hours of sample preparation. On-bead processing reduces handling and sample loss. Quantitation at the intact light chain level avoids dependence on peptide signatures, facilitating monitoring of mAbs with limited tryptic peptides and distinguishing them from endogenous IgG.
Advances in HRAM mass spectrometry will enable multiplexed quantitation of diverse antibody formats and bispecific constructs. Automation of on-bead digestion and integration with clinical platforms may support high-throughput therapeutic drug monitoring. Further miniaturization and direct sampling techniques could expand applications to point-of-care settings.
The described Protein L-based purification and Orbitrap Exploris 240 MS workflow achieves sensitive, selective, and reproducible quantitation of intact mAb light chains in serum. It offers a robust alternative to peptide-based assays, with potential for broader clinical implementation in therapeutic drug monitoring.
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesClinical Research
ManufacturerThermo Fisher Scientific
Summary
Significance of the Topic
Monoclonal antibodies (mAbs) are increasingly used in clinical therapy, with a projected market value exceeding $200 billion by 2026. Precise quantitation of therapeutic mAbs in patient serum is critical for optimizing dosing, ensuring efficacy, and minimizing adverse effects. Traditional peptide-based assays can be time-consuming and may struggle to distinguish therapeutic mAbs from endogenous immunoglobulins.
Aims and Study Overview
This study presents a rapid and selective workflow for quantifying intact light chains of therapeutic mAbs in human serum. By employing Protein L magnetic bead capture, on‐bead IdeS digestion and disulfide reduction, and high‐resolution accurate mass (HRAM) Orbitrap analysis, the authors aimed to establish limits of detection (LOD) and quantitation (LOQ), linear range, and reproducibility for six clinically relevant mAbs.
Methodology
Sample preparation involved spiking six target mAbs (adalimumab, bevacizumab, camrelizumab, daratumumab, golimumab, rituximab) at concentrations from 1 to 100 µg/mL into human serum. Two non‐overlapping mAbs (nivolumab, pembrolizumab) served as internal standards. Protein L magnetic beads selectively bound kappa light chain–containing antibodies, excluding lambda chains. Captured mAbs underwent on‐bead IdeS digestion at 37 °C and on‐bead reduction with TCEP at 57 °C, eliminating elution steps and minimizing sample loss. Following desalting and concentration, samples were analyzed by reversed-phase UHPLC coupled to an Orbitrap Exploris 240 MS under the BioPharma option.
Instrumentation
- Thermo Scientific Orbitrap Exploris 240 mass spectrometer with BioPharma option
- Vanquish Flex Binary UHPLC system
- MAbPac RP column (2.1 × 50 mm, 4 µm)
- Protein L magnetic beads (Thermo Scientific Pierce)
- TraceFinder software for targeted data extraction
Main Results and Discussion
High-resolution MS at >120 k resolving power enabled clear separation of isotopic clusters for light, heavy (Fd′), and Fc/2 subunits. Calibration curves for all six mAbs exhibited excellent linearity (R2>0.99). LOQs ranged from 1 to 5 µg/mL; LODs were between 1 and 5 µg/mL. Inter- and intra-day reproducibility yielded retention time variation <0.05 min within lots (<0.2 min between lots) and peak area differences <20% across columns.
Benefits and Practical Applications of the Method
This streamlined workflow requires only 10 µL of serum per analysis and under 1.5 hours of sample preparation. On-bead processing reduces handling and sample loss. Quantitation at the intact light chain level avoids dependence on peptide signatures, facilitating monitoring of mAbs with limited tryptic peptides and distinguishing them from endogenous IgG.
Future Trends and Opportunities
Advances in HRAM mass spectrometry will enable multiplexed quantitation of diverse antibody formats and bispecific constructs. Automation of on-bead digestion and integration with clinical platforms may support high-throughput therapeutic drug monitoring. Further miniaturization and direct sampling techniques could expand applications to point-of-care settings.
Conclusion
The described Protein L-based purification and Orbitrap Exploris 240 MS workflow achieves sensitive, selective, and reproducible quantitation of intact mAb light chains in serum. It offers a robust alternative to peptide-based assays, with potential for broader clinical implementation in therapeutic drug monitoring.
References
- Lu RM et al. Development of therapeutic antibodies for the treatment of diseases. Journal of Biomedical Science 2020;27:1.
- Antibody Drugs: Technologies and Global Markets. 2021.
- Marin C et al. Cross-validation of a multiplex LC-MS/MS method for assaying mAbs plasma levels in patients with cancer: A GPCO-UNICANCER study. Pharmaceuticals 2021;14:796.
- Cradic KW et al. Vedolizumab quantitation using high-resolution accurate mass middle-up protein subunit: method validation. Clin Chem Lab Med 2020;58:864.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duoprime, primemagnetic, magneticvqwkvdnalqsgnsqesvteqdsk
Flash Characterization of Antibodies via Microdroplet Reactions in an Unmodified Jet Stream Source
2023|Agilent Technologies|Applications
Application Note Biopharma Flash Characterization of Antibodies via Microdroplet Reactions in an Unmodified Jet Stream Source Authors Introduction Jim Lau, Hui Zhao, and Mike Knierman Agilent Technologies, Inc. Traditionally, antibody characterization with IdeS enzyme digestion, reduction with tris(2-carboxyethyl)phosphine (TCEP), triethylphosphine…
Key words
microdroplet, microdropletides, idesvedolizumab, vedolizumabreaction, reactionintact, intactmass, massherceptin, herceptincharge, chargeantibodies, antibodiesmab, mabreactions, reactionsjanssen, janssenscfc, scfcflow, flowjohnson
SMART Digest Peptide Mapping and Quantitation Compendium
2018|Thermo Fisher Scientific|Guides
Table of Contents Introduction Faster and More Sensitive Protein Characterization and Quantitation Easier Digestion Faster Digestion Highly Reproducible Digestion Automation of Digestion Improving Sensitivity and Speed SMART Digest Peptide Mapping and Quantitation Compendium Peptide Mapping Peptide Quantitation Product and Method…
Key words
mapping, mappingpeptide, peptidedigestion, digestionsmart, smartmodifications, modificationsdigest, digestposttranslational, posttranslationalchain, chainheavy, heavytrypsin, trypsinmonoclonal, monoclonalantibodies, antibodiesthroughput, throughputautomated, automatedprotein
Thermo Scientific Biopharmaceutical Characterisation Compendium
2019|Thermo Fisher Scientific|Guides
Biopharmaceutical Characterisation Compendium A complete toolbox of techniques, workflows and technologies for comprehensive biopharmaceutical characterisation Please click the circles to navigate INTRODUCTION AGGREGATE ANALYSIS CHARGE VARIANT ANALYSIS PEPTIDE MAPPING GLYCANS INTACT AND SUBUNIT ANALYSIS INTRODUCTION The resources collected in this…
Key words
mapping, mappingpeptide, peptideaggregate, aggregatevariant, variantglycans, glycanssponsored, sponsoredcharge, chargeanalysis, analysissubunit, subunitglycan, glycanintact, intactprotein, proteinmonoclonal, monoclonallinks, linksvanquish