Monitoring the intact light chain of therapeutic monoclonal antibodies in human serum using an Orbitrap Exploris 240 mass spectrometer for clinical research
Applications | 2022 | Thermo Fisher ScientificInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesClinical Research
ManufacturerThermo Fisher Scientific
Key wordslight, camrelizumab, beads, chain, golimumab, bevacizumab, daratumumab, pembrolizumab, adalimumab, mabs, intact, nivolumab, mab, abundane, rituximab, were, protein, purification, thermo, ides, saline, antibodies, arb, quantitation, serum, mass, human, clinical, digestion, orbitrap, kappa, disulfide, charge, isotopic, magnetic, final, bond, therapeutic, regions, scientific, research, subunits, retention, states, clusters, different, reduction, lots, mode, loss
Similar PDF
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duoprime, primemagnetic, magneticadalimumab
Flash Characterization of Antibodies via Microdroplet Reactions in an Unmodified Jet Stream Source
2023|Agilent Technologies|Applications
Application Note Biopharma Flash Characterization of Antibodies via Microdroplet Reactions in an Unmodified Jet Stream Source Authors Introduction Jim Lau, Hui Zhao, and Mike Knierman Agilent Technologies, Inc. Traditionally, antibody characterization with IdeS enzyme digestion, reduction with tris(2-carboxyethyl)phosphine (TCEP), triethylphosphine…
Key words
microdroplet, microdropletides, idesvedolizumab, vedolizumabreaction, reactionintact, intactmass, massherceptin, herceptincharge, chargeantibodies, antibodiesmab, mabreactions, reactionsjanssen, janssenscfc, scfcflow, flowjohnson
Assessing Oxidation in IgG1 Monoclonal Antibodies and Correlating at both Intact Protein and Peptide Levels
2020|Thermo Fisher Scientific|Posters
Assessing Oxidation in IgG1 Monoclonal Antibodies and Correlating at both Intact Protein and Peptide Levels Tom Buchanan1, Sara Carillo2, Kristina Srzentić3, Kai Scheffler4, Angela Criscuolo4, Silvia Millan Martin2, Jennifer Sutton5, Phil Widdowson1, Ken Cook1, Jonathan Bones2. 1Thermo Fisher Scientific, Hemel,…
Key words
ipilimumab, ipilimumabgolimumab, golimumabdtlmisr, dtlmisrintact, intactcontrol, controlstressed, stressedδmass, δmasssubunit, subunitabundance, abundancehcd, hcdrelative, relativeunmodified, unmodifiedfull, fullmin, minpeptide
Triple Quadrupole Mass Spectrometry (Xevo TQ-XS) for the Quantification of Monoclonal Antibody Light Chains in Plasma
2019|Waters|Applications
[ APPLICATION NOTE ] Triple Quadrupole Mass Spectrometry (Xevo TQ-XS) for the Quantification of Monoclonal Antibody Light Chains in Plasma Caitlin M. Dunning, Mary Lame, and Mark Wrona Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■ ■ Fast, reproducible, and…
Key words
chains, chainslight, lightquantification, quantificationadalimumab, adalimumabxevo, xevomab, mabmonoclonal, monoclonaltriple, tripleantibody, antibodypolyphenyl, polyphenylsubunit, subunitquadrupole, quadrupolebioresolve, bioresolvealkylation, alkylationplasma