Rapid Confirmation of GLP-1 Analog (Liraglutide) Using Agilent InfinityLab LC/MSD iQ

Brochures and specifications | 2024 | Agilent TechnologiesInstrumentation
LC/MS, LC/SQ
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the topic


Peptide therapeutics such as liraglutide are key in managing type 2 diabetes and related metabolic disorders. Ensuring the integrity and purity of these biopharmaceuticals through rapid molecular weight confirmation is critical for regulatory approval, quality control, and effective drug development.

Objectives and study overview


This study aims to develop a rapid method for intact mass confirmation of liraglutide using the Agilent InfinityLab LC/MSD iQ system. It evaluates different reversed-phase columns and acidic modifiers to optimize sensitivity, resolution, and compatibility with mass spectrometry.

Methodology


Analyses were performed on liraglutide solutions at 1 mg/mL and 100 µg/mL, using a flexible liquid chromatography setup to screen three column chemistries (AdvanceBio Peptide Mapping, Peptide Plus, Poroshell Aq-C18) and three acidic modifiers (0.1% formic acid, trifluoroacetic acid, difluoroacetic acid). Gradient conditions were optimized for each combination to assess peak shape, resolution, and MS response.

Instrumentation used


  • Agilent 1260 Infinity II Bio Prime LC system with flexible pump, multisampler, multicolumn thermostat, and diode array detector
  • Agilent InfinityLab Quick Change Valve for column switching
  • Agilent InfinityLab LC/MSD iQ with electrospray ionization (ESI) in positive mode
  • Agilent OpenLab CDS 2.8 software for data acquisition and deconvolution

Key results and discussion


The AdvanceBio Peptide Mapping column yielded the best overall performance. TFA provided superior UV peak shape but suppressed MS signals. DFA offered a balance between chromatographic behavior and MS sensitivity, detecting low-concentration impurities at 10 µg/mL that were not observed under TFA. FA delivered the highest MS sensitivity but exhibited poor peak symmetry. Deconvolution of multiple charge states (+3 to +6) using OpenLab CDS confirmed the intact mass of liraglutide at 3750.23 Da, matching theoretical values.

Benefits and practical applications


This approach enables fast screening of chromatographic conditions and reliable mass confirmation in a single workflow, supporting quality control of peptide therapeutics and accelerating late-stage development. The combination of versatile valve switching and sensitive mass detection ensures high data integrity.

Future trends and potential applications


Advances may include integration of microflow and high-throughput systems, novel ion-pairing reagents to enhance MS compatibility, and automated data analysis using artificial intelligence. Expanding mass range capabilities will allow application to larger proteins and complex biologics.

Conclusion


The Agilent InfinityLab LC/MSD iQ platform, combined with flexible chromatography and deconvolution software, provides a robust solution for rapid intact mass confirmation of liraglutide, balancing chromatographic performance and MS sensitivity for routine biopharmaceutical analysis.

References


  1. US FDA Guidance for Industry on synthetic peptide drug products referencing rDNA biologics (2021).
  2. EMA Guideline on the Development and Manufacture of Synthetic Peptides (2023).
  3. Unit Mass Spectral Deconvolution for Molecular Weight Confirmation of Large Molecules, Agilent Tech (2024).
  4. Simplify Method Development Using Agilent 1260 Infinity II Prime LC System and InfinityLab LC/MSD iQ, Agilent Tech (2020).

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Peptide Drug Stability Analysis Using Agilent InfinityLab LC/MSD and OpenLab CDS Deconvolution
Application Note Biopharmaceuticals Peptide Drug Stability Analysis Using Agilent InfinityLab LC/MSD and OpenLab CDS Deconvolution Author Chae-Young Ryu Agilent Technologies, Inc. Abstract The Federal Drug Administration (FDA) abbreviated new drug application (ANDA) guidelines advise qualitative and quantitative management of peptide-related…
Key words
abundance, abundancecounts, countsliraglutide, liraglutideimpurities, impuritiesinfinitylab, infinitylabsemaglutide, semaglutiderelative, relativemass, masspeptide, peptidemsd, msdcharge, chargedegradation, degradationdrug, drugmin, minanda
Workflow Solutions for Peptide Therapeutics - Application Compendium
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabimpurities, impuritiessemaglutide, semaglutidesynthetic, syntheticmsd, msdtherapeutics, therapeuticsnotes
Characterization of Synthetic Peptide Drug and Impurities using High-Performance Liquid Chromatography (HPLC) and Liquid Chromatography/Mass Spectrometry (LC/MS)
Characterization of Synthetic Peptide Drug and Impurities using High-Performance Liquid Chromatography (HPLC) and Liquid Chromatography/Mass Spectrometry (LC/MS) 1D Column Column Agilent AdvanceBio Peptide Mapping 120Å, 2.1 x 150mm, 2.7 µm 0.4 mL/min Injection volume 20 μL Column temperature A) B)…
Key words
daltons, daltonsozempic, ozempicabundance, abundancesemaglutide, semaglutidemass, massamino, aminoopa, opasynthetic, syntheticcounts, countstime, timesource, sourcemin, minacid, acidinfinitylab, infinitylabapi
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike