Quantification of Glucagon-Like Peptide-1 Agonist Tirzepatide Using an Agilent 6495D Triple Quadrupole LC/MS System
Applications | 2024 | Agilent TechnologiesInstrumentation
Peptide therapeutics such as the GLP-1 receptor agonist tirzepatide play a critical role in treating type 2 diabetes and obesity. Monitoring peptide integrity during manufacturing and storage is essential because chemical modifications can impact safety and efficacy. Highly sensitive and robust quantitative methods are therefore indispensable in biopharmaceutical development and quality control.
This study aimed to develop a rapid and precise multiple reaction monitoring (MRM)-based LC/MS method for quantifying both unmodified (native) and mono-oxidized tirzepatide. Key goals included establishing limits of quantitation (LOQs), assessing dynamic range, and evaluating accuracy and precision for stability testing and impurity profiling.
Sample Preparation:
Chromatography and Mass Spectrometry:
The native tirzepatide method exhibited a linear range of 0.025–250 ng/mL (R²=0.997) with LOQ at 0.025 ng/mL, while the oxidized form ranged 0.25–250 ng/mL (R²=0.996) with LOQ at 0.25 ng/mL. Retention times were 4.0 min (native) and 3.9 min (oxidized). Precision (%CV) remained below 6% across all levels, and accuracy ranged from 81 % to 118 %, meeting regulatory criteria.
The method delivers rapid 8-minute runs, high sensitivity for low-level detection, and reproducible quantitation of peptide drug and degradation products. It is well suited for stability studies, batch release testing, and impurity characterization in peptide drug development.
Expanding this MRM-based approach to multi-peptide panels could support simultaneous quantitation of diverse biotherapeutics. Integration with automated sample preparation and high-throughput screening will accelerate early-stage development. Advanced data analytics may further enhance detection of complex post-translational modifications.
An Agilent 6495D triple quadrupole LC/MS workflow with MRM detection offers a fast, sensitive, and precise solution for quantifying native and oxidized tirzepatide. The validated method meets stringent performance criteria, making it a reliable tool for peptide therapeutic analysis.
LC/MS, LC/MS/MS, LC/QQQ
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Significance of Topic
Peptide therapeutics such as the GLP-1 receptor agonist tirzepatide play a critical role in treating type 2 diabetes and obesity. Monitoring peptide integrity during manufacturing and storage is essential because chemical modifications can impact safety and efficacy. Highly sensitive and robust quantitative methods are therefore indispensable in biopharmaceutical development and quality control.
Objectives and Study Overview
This study aimed to develop a rapid and precise multiple reaction monitoring (MRM)-based LC/MS method for quantifying both unmodified (native) and mono-oxidized tirzepatide. Key goals included establishing limits of quantitation (LOQs), assessing dynamic range, and evaluating accuracy and precision for stability testing and impurity profiling.
Methodology and Instrumentation
Sample Preparation:
- Tirzepatide dissolved at 1.0 mg/mL in methanol and serially diluted (0.025–250 ng/mL) in 30% ACN with 2% DFA for calibration; QC samples at 0.75, 7.5, and 75 ng/mL.
- Mono-oxidized form generated by incubating 0.5 mg/mL peptide in 30% ACN with 2% H₂O₂ overnight.
Chromatography and Mass Spectrometry:
- Agilent AdvanceBio Peptide Mapping column (2.1×150 mm, 2.7 µm) with an 8-minute gradient (0.1% DFA in water/ACN).
- Agilent 6495D triple quadrupole LC/MS with Jet Stream ESI source, positive mode, optimized gas and voltage settings.
- MRM transitions selected from [M+5H]⁵⁺ precursor ions at m/z 1,204.4 (native) and 1,208.1 (oxidized), monitoring the y₄ fragment at m/z 396.3.
Key Results and Discussion
The native tirzepatide method exhibited a linear range of 0.025–250 ng/mL (R²=0.997) with LOQ at 0.025 ng/mL, while the oxidized form ranged 0.25–250 ng/mL (R²=0.996) with LOQ at 0.25 ng/mL. Retention times were 4.0 min (native) and 3.9 min (oxidized). Precision (%CV) remained below 6% across all levels, and accuracy ranged from 81 % to 118 %, meeting regulatory criteria.
Benefits and Practical Applications
The method delivers rapid 8-minute runs, high sensitivity for low-level detection, and reproducible quantitation of peptide drug and degradation products. It is well suited for stability studies, batch release testing, and impurity characterization in peptide drug development.
Future Trends and Applications
Expanding this MRM-based approach to multi-peptide panels could support simultaneous quantitation of diverse biotherapeutics. Integration with automated sample preparation and high-throughput screening will accelerate early-stage development. Advanced data analytics may further enhance detection of complex post-translational modifications.
Conclusion
An Agilent 6495D triple quadrupole LC/MS workflow with MRM detection offers a fast, sensitive, and precise solution for quantifying native and oxidized tirzepatide. The validated method meets stringent performance criteria, making it a reliable tool for peptide therapeutic analysis.
Reference
- Müller T.D. et al. "Glucagon-Like Peptide 1 (GLP-1)." Mol. Metab. 30 (2019): 72–130.
- U.S. Food and Drug Administration. "FDA Approves New Medication for Chronic Weight Management," Nov. 8, 2023.
- Suresh Babu C.V. "Characterization of Forced Degradation Impurities of GLP-1 Agonists by LC/Q-TOF Mass Spectrometry," Agilent Technologies Application Note 5994-7794EN (2024).
- U.S. Food and Drug Administration. "Bioanalytical Method Validation Guidance for Industry," May 2018.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Characterization and Quantification of Glucagon Like Peptide-1 Agonists and their Impurities Using Liquid Chromatography/Mass Spectrometry (LC/MS)
2025|Agilent Technologies|Posters
Poster Reprint ASMS 2025 Poster number TP 625 Characterization and Quantification of Glucagon Like Peptide-1 Agonists and their Impurities Using Liquid Chromatography/Mass Spectrometry (LC/MS) David L. Wong1 , Suresh Babu C.V.2 1Agilent Technologies, Inc., Santa Clara, CA, USA 2Agilent Technologies,…
Key words
oxidation, oxidationcounts, countsmono, monotirzepatide, tirzepatidenative, nativeoxidized, oxidizedtri, triacquisition, acquisitioncharge, chargemass, massliraglutide, liraglutideorders, ordersmagnitude, magnitudedeconvoluted, deconvolutedunmodified
Workflows for GLP-1 Receptor Agonists and Therapeutic Peptides: Identity, Impurity, Bioanalysis, and Stability Testing
2026|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Workflows for GLP-1 Receptor Agonists and Therapeutic Peptides: Identity, Impurity, Bioanalysis, and Stability Testing Contents Raw Material Purity and Impurity Identification Analysis Bioanalysis Stability Testing Studies Contents Introduction 02 1 Raw Material Identification 03 1.1 Verification…
Key words
bioanalysis, bioanalysisimpurity, impurityraw, rawstudies, studiespurity, puritycontents, contentsstability, stabilitytesting, testingmaterial, materialidentification, identificationexenatide, exenatidetirzepatide, tirzepatidesemaglutide, semaglutidepeptide, peptideliraglutide
Workflow Solutions for Peptide Therapeutics - Application Compendium
2025|Agilent Technologies|Guides
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabimpurities, impuritiessemaglutide, semaglutidesynthetic, syntheticmsd, msdtherapeutics, therapeuticsnotes