LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analog Tirzepatidein Plasma Using Automated LC-MS/MS workflow

Posters | 2025 | Agilent Technologies | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the Topic


Glucagon-like peptide-1 receptor (GLP-1R) agonists such as tirzepatide have transformed obesity and type 2 diabetes management. Accurate quantitation of these peptides in plasma is essential for pharmacokinetic and toxicokinetic evaluation during drug development.

Objectives and Study Overview


This study aimed to develop an automated LC-MS/MS workflow for sensitive and reproducible quantitation of tirzepatide in human plasma. It compared traditional organic solvent precipitation with AssayMAP RP-S cartridge cleanup to enhance assay performance.

Methodology


A 100 µL plasma aliquot fortified with tirzepatide and semaglutide (internal standard) underwent protein precipitation using a 1:1 acetonitrile:methanol mixture. After centrifugation and drying, samples were reconstituted, then processed on the AssayMAP Bravo platform with RP-S cartridges. Key steps included:
  • Conditioning cartridges with 80% acetonitrile and water.
  • Loading samples in water at 3 µL/min.
  • Washing with water and 10% acetonitrile in 10 mM ammonium formate (pH 10).
  • Elution with 5% formic acid in 80% acetonitrile.
The final eluate was analyzed by UHPLC on an AdvanceBio Peptide Mapping column (2.1×150 mm, 2.7 µm) at 80 °C coupled to an Agilent 6495D triple quadrupole mass spectrometer. MRM transitions 1204.4→396.2 and 1204.4→299.2 were used for tirzepatide quantitation.

Instrumentation Used


  • AssayMAP Bravo automated sample preparation platform.
  • Agilent 1290 Infinity II Bio UHPLC system with AdvanceBio Peptide Mapping column.
  • Agilent 6495D Triple Quadrupole LC/TQ mass spectrometer.

Key Results and Discussion


  • The optimized precipitation solvent (ACN:MeOH 1:1) maximized peptide recovery.
  • Pure water was the best loading buffer; 10% ACN in ammonium formate (pH 10) provided optimal wash conditions.
  • Elution with 5% formic acid in 80% ACN delivered the highest sensitivity.
  • Assay sensitivity improved fivefold over precipitation alone, achieving an LLOQ of 0.05 ng/mL.
  • Calibration curves were linear (R² > 0.996) from 0.05 to 1000 ng/mL, covering 4.5 orders of magnitude.
  • Intra- and inter-day precision and accuracy met regulatory criteria (≤20% at LLOQ, ≤15% at other QC levels).

Benefits and Practical Applications


The automated workflow reduces manual steps and variability, enabling high-throughput, reliable bioanalytical support for clinical and preclinical tirzepatide studies.

Future Trends and Potential Applications


As GLP-1 analog therapies expand, combining automated platforms with high-sensitivity MS will facilitate personalized dosing and multiplexed peptide panels. Ongoing miniaturization and method integration will further enhance throughput and data quality.

Conclusion


This automated LC-MS/MS assay delivers robust, sensitive, and reproducible quantitation of tirzepatide in plasma, supporting comprehensive pharmacokinetic assessments in drug development.

References


  1. Mounjaro (tirzepatide) injection, solution. DailyMed. May 13, 2022.
  2. Zepbound (tirzepatide) injection, solution. DailyMed. Nov 9, 2023.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Comprehensive workflow for Automated Sample Cleanup and Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analogs from Plasma
Poster Reprint ASMS 2025 Poster number ThP 595 Comprehensive workflow for Automated Sample Cleanup and Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analogs from Plasma Xi Qiu1, Steve Murphy1, David L. Wong2 1Agilent Technologies, Inc., Wilmington, DE 2Agilent Technologies, Inc., Santa…
Key words
assaymap, assaymapbias, biasmean, meanday, daygas, gasassay, assayrelative, relativesemagluatide, semagluatideinter, intersurged, surgedresponses, responsesautomated, automatedsheath, sheathwere, werecrash
Sensitive Quantitation of Glucagon-Like Peptide-1 (GLP-1) Analog Tirzepatide in Plasma
Application Note Biopharma/Pharma Sensitive Quantitation of Glucagon‑Like Peptide-1 (GLP-1) Analog Tirzepatide in Plasma Using an automated workflow with the Agilent 6495D triple quadrupole LC/MS Authors Xi Qiu, Steve Murphy, and David L. Wong Agilent Technologies, Inc. Abstract Sensitive bioanalytical assays…
Key words
tirzepatide, tirzepatidebias, biasmean, meanlobind, lobindquantitative, quantitativesemaglutide, semaglutideinterday, interdayassaymap, assaymappharmacokinetics, pharmacokineticsmasshunter, masshunterrelative, relativepeptide, peptidecounts, countsbioanalytical, bioanalyticalzepbound
Sensitive Quantitation of Glucagon-Like Peptide-1 (GLP-1) Analog Semaglutide from Plasma
Application Note Biopharma/Pharma Sensitive Quantitation of Glucagon‑Like Peptide-1 (GLP-1) Analog Semaglutide from Plasma Comprehensive workflow for automated sample cleanup and sensitive quantitation Authors Xi Qiu, Steve Murphy, and David L. Wong Agilent Technologies, Inc. Abstract Sensitive bioanalytical assays to determine…
Key words
semaglutide, semaglutideassaymap, assaymapplasma, plasmabias, biasmean, meantoxicokinetics, toxicokineticslobind, lobindquantitative, quantitativehuman, humanlloq, lloqtirzepatide, tirzepatidecounts, countsinterday, interdaypharmacokinetics, pharmacokineticsworkflow
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Other projects
GCMS
ICPMS
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike