Sensitive Quantitation of Glucagon-Like Peptide-1 (GLP-1) Analog Tirzepatide in Plasma
Applications | 2025 | Agilent TechnologiesInstrumentation
The rise of glucagon like peptide 1 receptor agonists such as tirzepatide for the treatment of obesity and type 2 diabetes has created a critical need for sensitive and specific bioanalytical assays. Accurate quantitation of these large peptide therapeutics in plasma supports pharmacokinetic and toxicokinetic studies that drive drug discovery and regulatory approval.
This work presents an automated LC MS workflow combining Agilent AssayMAP Bravo sample preparation, 1290 Infinity II bio UHPLC, and 6495D triple quadrupole mass spectrometry to measure tirzepatide in human plasma. The aim was to develop a rapid method without the need for immunoaffinity reagents that achieves a low limit of quantitation and a wide linear range.
Sample preparation was performed on the Agilent AssayMAP Bravo platform with the following steps
An extensive optimization was carried out to maximize recovery sensitivity and reproducibility
The optimized method achieved a lower limit of quantitation of 0.05 ng/mL using 100 uL of plasma and maintained linearity up to 1000 ng/mL with correlation coefficients above 0.999. Intra and interday precision and accuracy across low mid and high quality control levels met regulatory acceptance criteria of ±15.
This automated LC MS workflow provides
Advances in bioanalytical technologies may include integration of microflow LC MS for further sensitivity gains higher throughput robotic sample handling and broader multiplexing of peptide therapeutics. The method can be extended to new peptide modalities and adapted for clinical safety and efficacy monitoring.
The described automated LC MS platform delivers robust quantitation of tirzepatide in human plasma with excellent sensitivity accuracy and precision. Eliminating the need for antibody reagents accelerates assay setup and supports drug discovery and development efforts for GLP 1 based therapies.
LC/MS, LC/QQQ, LC/MS/MS
IndustriesPharma & Biopharma, Clinical Research, Proteomics
ManufacturerAgilent Technologies
Summary
Importance of the topic
The rise of glucagon like peptide 1 receptor agonists such as tirzepatide for the treatment of obesity and type 2 diabetes has created a critical need for sensitive and specific bioanalytical assays. Accurate quantitation of these large peptide therapeutics in plasma supports pharmacokinetic and toxicokinetic studies that drive drug discovery and regulatory approval.
Objectives and study overview
This work presents an automated LC MS workflow combining Agilent AssayMAP Bravo sample preparation, 1290 Infinity II bio UHPLC, and 6495D triple quadrupole mass spectrometry to measure tirzepatide in human plasma. The aim was to develop a rapid method without the need for immunoaffinity reagents that achieves a low limit of quantitation and a wide linear range.
Methodology and instrumentation
Sample preparation was performed on the Agilent AssayMAP Bravo platform with the following steps
- Protein precipitation using a 1 1 mixture of acetonitrile and methanol spiked with semaglutide as internal standard
- Automated purification on AssayMAP RP S cartridges with conditioning equilibrating loading washing and elution steps
- Reconstitution of dried eluates and injection into LC MS
Used instrumentation
- Agilent AssayMAP Bravo protein sample prep platform
- Agilent 1290 Infinity II bio high speed pump multisampler and column thermostat
- Agilent 6495D triple quadrupole LC MS with Jet Stream electrospray
- Agilent AdvanceBio Peptide Mapping column for chromatographic separation
Main results and discussion
An extensive optimization was carried out to maximize recovery sensitivity and reproducibility
- Precipitation solvent composition was compared including pure acetonitrile pure methanol and a 1 1 mixture with the latter providing the best peptide extraction
- Loading buffer experiments showed that pure water offered optimal binding to the RP S cartridge
- Washing conditions were optimized to an aqueous ammonium formate buffer with 10 acidified acetonitrile to remove interferences
- Elution was most effective using 80 acetonitrile containing 5 formic acid
The optimized method achieved a lower limit of quantitation of 0.05 ng/mL using 100 uL of plasma and maintained linearity up to 1000 ng/mL with correlation coefficients above 0.999. Intra and interday precision and accuracy across low mid and high quality control levels met regulatory acceptance criteria of ±15.
Benefits and practical applications
This automated LC MS workflow provides
- High sensitivity and specificity without immunoassay reagents
- Rapid method development and high throughput capability
- Wide dynamic range to support pharmacokinetic profiling
- A universal approach applicable to other GLP 1 analogs
Future trends and possibilities
Advances in bioanalytical technologies may include integration of microflow LC MS for further sensitivity gains higher throughput robotic sample handling and broader multiplexing of peptide therapeutics. The method can be extended to new peptide modalities and adapted for clinical safety and efficacy monitoring.
Conclusion
The described automated LC MS platform delivers robust quantitation of tirzepatide in human plasma with excellent sensitivity accuracy and precision. Eliminating the need for antibody reagents accelerates assay setup and supports drug discovery and development efforts for GLP 1 based therapies.
Reference
- Mounjaro tirzepatide injection solution DailyMed 13 May 2022
- Zepbound tirzepatide injection solution DailyMed 9 Nov 2023
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Sensitive Quantitation of Glucagon-Like Peptide-1 (GLP-1) Analog Semaglutide from Plasma
2025|Agilent Technologies|Applications
Application Note Biopharma/Pharma Sensitive Quantitation of Glucagon‑Like Peptide-1 (GLP-1) Analog Semaglutide from Plasma Comprehensive workflow for automated sample cleanup and sensitive quantitation Authors Xi Qiu, Steve Murphy, and David L. Wong Agilent Technologies, Inc. Abstract Sensitive bioanalytical assays to determine…
Key words
semaglutide, semaglutideassaymap, assaymapbias, biasplasma, plasmatoxicokinetics, toxicokineticsmean, meanlobind, lobindquantitative, quantitativehuman, humanlloq, lloqtirzepatide, tirzepatidecounts, countsinterday, interdaypharmacokinetics, pharmacokineticsassay
Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analog Tirzepatidein Plasma Using Automated LC-MS/MS workflow
2025|Agilent Technologies|Posters
Poster Reprint ASMS 2025 Poster number MP 229 Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analog Tirzepatide in Plasma Using Automated LC-MS/MS workflow Xi Qiu1, Steve Murphy1, David L. Wong2 1Agilent Technologies, Wilmington, DE 2Agilent Technologies, Santa Clara, CA Introduction In…
Key words
bias, biasmean, meantirzepatide, tirzepatideday, dayrelative, relativegas, gashuman, humanplasma, plasmainter, intertoxicokinetics, toxicokineticssurged, surgedresponses, responsessheath, sheathglucagon, glucagonconcentration
Comprehensive workflow for Automated Sample Cleanup and Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analogs from Plasma
2025|Agilent Technologies|Posters
Poster Reprint ASMS 2025 Poster number ThP 595 Comprehensive workflow for Automated Sample Cleanup and Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analogs from Plasma Xi Qiu1, Steve Murphy1, David L. Wong2 1Agilent Technologies, Inc., Wilmington, DE 2Agilent Technologies, Inc., Santa…
Key words
assaymap, assaymapbias, biasmean, meangas, gasassay, assayday, dayrelative, relativesemagluatide, semagluatideinter, intersurged, surgedresponses, responsesautomated, automatedsheath, sheathwere, weresemaglutide
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance