Sensitive Quantitation of Glucagon-Like Peptide-1 (GLP-1) Analog Semaglutide from Plasma
Applications | 2025 | Agilent TechnologiesInstrumentation
The emergence of glucagon-like peptide-1 (GLP-1) receptor agonists, particularly semaglutide, has transformed treatment strategies for obesity and type 2 diabetes. Bioanalytical assays with high sensitivity and specificity are vital to characterize pharmacokinetics and toxicokinetics, accelerating drug discovery and regulatory approval pathways.
This study aimed to develop and validate an automated LC/MS workflow for quantifying semaglutide in human plasma without antibody reagents. Key goals included enhancing assay sensitivity, expanding dynamic range, and reducing manual sample preparation steps to support high-throughput analysis in preclinical and clinical research.
The workflow comprised two main stages:
Method optimization focused on solvent composition, buffer conditions, and SPE parameters:
Quantitative performance:
This automated platform offers:
Advancements may include multiplexed quantitation of diverse peptide therapeutics, integration with microflow LC for sample economy, and application to endogenous peptide biomarkers. Further miniaturization and on-line automation will support personalized dosing studies and translational research.
The presented automated LC/MS assay delivers robust, high-sensitivity quantitation of semaglutide in human plasma. By combining Agilent AssayMAP cleanup, 1290 Infinity II LC, and 6495D TQMS, the method achieves a 0.2 ng/mL LLOQ, wide dynamic range, and regulatory-grade precision. This universal approach streamlines peptide bioanalysis across discovery and clinical phases.
LC/MS, LC/QQQ, LC/MS/MS
IndustriesPharma & Biopharma, Clinical Research, Proteomics
ManufacturerAgilent Technologies
Summary
Significance of the Topic
The emergence of glucagon-like peptide-1 (GLP-1) receptor agonists, particularly semaglutide, has transformed treatment strategies for obesity and type 2 diabetes. Bioanalytical assays with high sensitivity and specificity are vital to characterize pharmacokinetics and toxicokinetics, accelerating drug discovery and regulatory approval pathways.
Objectives and Study Overview
This study aimed to develop and validate an automated LC/MS workflow for quantifying semaglutide in human plasma without antibody reagents. Key goals included enhancing assay sensitivity, expanding dynamic range, and reducing manual sample preparation steps to support high-throughput analysis in preclinical and clinical research.
Methodology
The workflow comprised two main stages:
- Sample Cleanup
• Protein precipitation using acetonitrile:methanol (1:1) on 100 µL plasma spiked with semaglutide and tirzepatide internal standard.
• Automated solid-phase extraction on Agilent AssayMAP RP-S cartridges for further purification. - LC/MS Analysis
• Agilent 1290 Infinity II bio UHPLC with AdvanceBio Peptide Mapping column (2.1×150 mm, 2.7 µm) at 80 °C.
• Gradient elution from 30% to 95% acetonitrile with 0.1% formic acid at 0.4 mL/min.
• Agilent 6495D triple quadrupole mass spectrometer in positive electrospray mode.
• MRM transitions optimized: semaglutide [M+4H]4+ (m/z 1029.4 → 1238.1 quantifier, 1029.4 → 136.1 qualifier), tirzepatide (1204.4 → 396.2).
Instrumentation
- Agilent AssayMAP Bravo protein sample prep platform
- Agilent 1290 Infinity II bio LC system (pump, multisampler, column compartment)
- Agilent 6495D triple quadrupole LC/MS with Jet Stream ESI source
- Agilent AdvanceBio Peptide Mapping column
Key Results and Discussion
Method optimization focused on solvent composition, buffer conditions, and SPE parameters:
- ACN:MeOH (1:1) achieved highest peptide recovery in precipitation.
- Pure water as loading buffer, 10 mM ammonium formate pH 10 with 10% ACN for washing, and 5% formic acid in 80% ACN for elution maximized cleanliness.
- Automated AssayMAP cleanup enhanced sensitivity fivefold compared to conventional precipitation.
Quantitative performance:
- Lower limit of quantification (LLOQ): 0.2 ng/mL with signal-to-noise > 10.
- Linear dynamic range: 0.2–1000 ng/mL (R2 = 0.9946, weighted 1/x2).
- Intra- and interday precision and accuracy within ±15% across QC levels (LLOQ, low, mid, high).
Benefits and Practical Applications
This automated platform offers:
- Ultra-sensitive detection of GLP-1 analogs without immunoassays.
- High specificity via MRM transitions and peptide mapping column.
- Reduced hands-on time and improved reproducibility.
- Applicability to multiple GLP-1 therapeutics in drug development workflows.
Future Trends and Applications
Advancements may include multiplexed quantitation of diverse peptide therapeutics, integration with microflow LC for sample economy, and application to endogenous peptide biomarkers. Further miniaturization and on-line automation will support personalized dosing studies and translational research.
Conclusion
The presented automated LC/MS assay delivers robust, high-sensitivity quantitation of semaglutide in human plasma. By combining Agilent AssayMAP cleanup, 1290 Infinity II LC, and 6495D TQMS, the method achieves a 0.2 ng/mL LLOQ, wide dynamic range, and regulatory-grade precision. This universal approach streamlines peptide bioanalysis across discovery and clinical phases.
References
- Ozempic – semaglutide injection, solution. DailyMed. 5 June 2021.
- Rybelsus – oral semaglutide tablet. DailyMed. 5 June 2021.
- Wegovy – semaglutide injection, solution. 14 Dec. 2021.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Sensitive Quantitation of Glucagon-Like Peptide-1 (GLP-1) Analog Tirzepatide in Plasma 
2025|Agilent Technologies|Applications
Application Note Biopharma/Pharma Sensitive Quantitation of Glucagon‑Like Peptide-1 (GLP-1) Analog Tirzepatide in Plasma Using an automated workflow with the Agilent 6495D triple quadrupole LC/MS Authors Xi Qiu, Steve Murphy, and David L. Wong Agilent Technologies, Inc. Abstract Sensitive bioanalytical assays…
Key words
tirzepatide, tirzepatidebias, biasmean, meanlobind, lobindquantitative, quantitativesemaglutide, semaglutideassaymap, assaymapinterday, interdaypharmacokinetics, pharmacokineticsmasshunter, masshunterrelative, relativepeptide, peptidecounts, countsbioanalytical, bioanalyticalzepbound
Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analog Tirzepatidein Plasma Using Automated LC-MS/MS workflow
2025|Agilent Technologies|Posters
Poster Reprint ASMS 2025 Poster number MP 229 Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analog Tirzepatide in Plasma Using Automated LC-MS/MS workflow Xi Qiu1, Steve Murphy1, David L. Wong2 1Agilent Technologies, Wilmington, DE 2Agilent Technologies, Santa Clara, CA Introduction In…
Key words
bias, biasmean, meantirzepatide, tirzepatideday, dayrelative, relativehuman, humanplasma, plasmagas, gasinter, intertoxicokinetics, toxicokineticssurged, surgedresponses, responsessheath, sheathglucagon, glucagonconcentration
Comprehensive workflow for Automated Sample Cleanup and Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analogs from Plasma
2025|Agilent Technologies|Posters
Poster Reprint ASMS 2025 Poster number ThP 595 Comprehensive workflow for Automated Sample Cleanup and Sensitive Quantitation of Glucagon-like peptide-1 (GLP-1) Analogs from Plasma Xi Qiu1, Steve Murphy1, David L. Wong2 1Agilent Technologies, Inc., Wilmington, DE 2Agilent Technologies, Inc., Santa…
Key words
assaymap, assaymapbias, biasmean, meanassay, assayday, daygas, gasrelative, relativesemagluatide, semagluatideinter, intersurged, surgedresponses, responsesautomated, automatedsheath, sheathwere, weresemaglutide
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg