Ultrafast Antibody Peptide Mapping with the Agilent 6545XT AdvanceBio LC/Q-TOF
Technical notes | 2026 | Agilent TechnologiesInstrumentation
Antibody peptide mapping and characterization are central to biopharmaceutical development, quality control, and stability assessment. Rapid, reproducible peptide mapping methods reduce turnaround time, limit artifactual modifications introduced during sample preparation, and enable near-real-time monitoring of critical quality attributes (CQAs) such as deamidation and methionine oxidation. The microdroplet digestion approach coupled with high-resolution LC/Q-TOF MS promises millisecond-scale digestion, streamlined workflows, and robust quantitative capabilities relevant to R&D and QC laboratories.
This technical overview demonstrates an automated, ultrafast online microdroplet trypsin digestion workflow integrated with an Agilent 6545XT AdvanceBio LC/Q-TOF and Agilent 1290 Infinity II LC. The goals were to: (1) achieve enzymatic digestion in sub-millisecond timescales during automated flow injection, (2) obtain deep sequence coverage through iterative MS/MS, (3) monitor and quantify key antibody PTMs (asparagine deamidation and methionine oxidation), and (4) enable fast, accurate absolute antibody quantification using isotope-labeled standards.
Samples: Reduced and alkylated NIST mAb and bevacizumab were used as model monoclonal antibodies. Trypsin (sequencing-grade) and antibody solutions were stored in the LC autosampler at ~6 °C.
Online microdroplet digestion workflow:
The approach eliminated lengthy in-solution digestion steps and enabled continuous sample introduction compatible with routine LC automation.
Key instruments used in the study were:
Representative MS source and acquisition parameters (summarized): positive AJS-ESI ionization; drying gas ~350 °C, 12 L/min; sheath gas ~400 °C, 12 L/min; nebulizer ~60 psi; capillary voltage ~3.5 kV; fragmentor ~130 V; skimmer ~65 V; MS range m/z ~250–3,200; acquisition ~4 spectra/s. These settings supported rapid MS and targeted MS/MS for peptide identification and CQA monitoring.
Digestion efficiency and sequence coverage:
Monitoring deamidation:
Methionine oxidation quantification:
Absolute antibody quantification:
The reported online microdroplet trypsin digestion coupled with Agilent 6545XT AdvanceBio LC/Q-TOF achieves ultrafast proteolysis, high sequence coverage through iterative MS/MS, reliable PTM characterization (site-resolved deamidation and methionine oxidation), and accurate absolute antibody quantification using isotope-labeled standards. The approach reduces sample prep artifacts, supports automated flow-injection cycles (~2-minute routines), and offers a compelling workflow for accelerated antibody characterization in research and biopharma environments.
LC/MS, LC/MS/MS, LC/TOF, LC/HRMS
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Significance of the topic
Antibody peptide mapping and characterization are central to biopharmaceutical development, quality control, and stability assessment. Rapid, reproducible peptide mapping methods reduce turnaround time, limit artifactual modifications introduced during sample preparation, and enable near-real-time monitoring of critical quality attributes (CQAs) such as deamidation and methionine oxidation. The microdroplet digestion approach coupled with high-resolution LC/Q-TOF MS promises millisecond-scale digestion, streamlined workflows, and robust quantitative capabilities relevant to R&D and QC laboratories.
Objectives and study overview
This technical overview demonstrates an automated, ultrafast online microdroplet trypsin digestion workflow integrated with an Agilent 6545XT AdvanceBio LC/Q-TOF and Agilent 1290 Infinity II LC. The goals were to: (1) achieve enzymatic digestion in sub-millisecond timescales during automated flow injection, (2) obtain deep sequence coverage through iterative MS/MS, (3) monitor and quantify key antibody PTMs (asparagine deamidation and methionine oxidation), and (4) enable fast, accurate absolute antibody quantification using isotope-labeled standards.
Methodology
Samples: Reduced and alkylated NIST mAb and bevacizumab were used as model monoclonal antibodies. Trypsin (sequencing-grade) and antibody solutions were stored in the LC autosampler at ~6 °C.
Online microdroplet digestion workflow:
- Automated flow injection: protein and trypsin aliquots (1 µL each; typically 1 µg/µL protein and 0.1 µg/µL trypsin, protein:enzyme ~10:1) were serially aspirated, mixed in the autosampler/injection loop, and injected into the flow path.
- Flow conditions: short flow-injection (2-minute cycle) at 100–300 µL/min into an Agilent Jet Stream source generated microdroplets; digestion occurs within the microdroplet transit time (reported <1 ms per prior literature).
- Iterative acquisition: multiple injections with dynamic exclusion of previously selected precursors improved MS/MS depth and peptide coverage.
The approach eliminated lengthy in-solution digestion steps and enabled continuous sample introduction compatible with routine LC automation.
Instrumentation used
Key instruments used in the study were:
- Agilent 6545XT AdvanceBio LC/Q-TOF operated in high-resolution mode (4 GHz dynamic range).
- Agilent 1290 Infinity II LC system configured for flow-injection analysis and automated sample handling.
Representative MS source and acquisition parameters (summarized): positive AJS-ESI ionization; drying gas ~350 °C, 12 L/min; sheath gas ~400 °C, 12 L/min; nebulizer ~60 psi; capillary voltage ~3.5 kV; fragmentor ~130 V; skimmer ~65 V; MS range m/z ~250–3,200; acquisition ~4 spectra/s. These settings supported rapid MS and targeted MS/MS for peptide identification and CQA monitoring.
Main results and discussion
Digestion efficiency and sequence coverage:
- Microdroplet digestion produced a marked loss of intact heavy- and light-chain signals and abundant tryptic peptides in the m/z 300–1,300 range, indicating efficient proteolysis during flow injection.
- Iterative MS/MS runs increased identification depth: MS/MS alone produced ~53% sequence coverage, most identified peptides had intensities >5,000 counts, and combined MS + MS/MS data yielded overall sequence coverage up to ~91%.
Monitoring deamidation:
- The peptide GFYPSDIAVEWESNGQPENNYK (example sequence) was used to localize deamidation sites by comparing fragment-ion patterns (y6 and y10) from control and intentionally deamidated samples (incubation in 1 M Tris pH 8 for 5–7 days).
- Results showed minimal deamidation at N392 and N393 (NN motif) but substantial deamidation at N387 (NG motif), consistent with sequence-context dependence: Asn followed by small residues is more susceptible to deamidation.
- deamidation increased with incubation time and alkaline stress, and MS/MS fragment ion quantification enabled site-resolved assessment.
Methionine oxidation quantification:
- The DTLMISR peptide (proximal to FcRn-binding region) was monitored for oxidation via the +2 ions of native (m/z ~418.22) and oxidized (+16 Da, m/z ~426.22) forms.
- Microdroplet digestion produced lower apparent oxidation (≈4.7%) than in-solution digestion (≈6.1%), suggesting reduced artifactual oxidation during online processing.
- Targeted MS/MS (y-ion shifts of +16 Da) confirmed methionine oxidation, and standard-addition/absolute quantification using synthetic peptides revealed that the oxidized peptide exhibited higher ionization efficiency—necessitating correction of relative quantification results.
Absolute antibody quantification:
- Absolute quantification was implemented by spiking light bevacizumab with a heavy-isotope-labeled bevacizumab internal standard (1:1 mass ratio). Ten proteotypic peptide pairs (heavy/light) were detected with near 1:1 signal ratios after microdroplet digestion.
- The ALPAPIEK peptide served as an example proteotypic surrogate: heavy and light forms were separated by an 8 Da mass shift; MS1 and MS/MS fragment ratios reflected the expected heavy:light mixing ratios (e.g., a 2:1 mix yielded ~2:1 ion intensities).
- A calibration based on a labeled heavy-to-light peak-intensity ratio produced excellent linearity (R² ≈ 0.99), and quantification accuracy approximated theoretical injection amounts (example: measured 12.58 ng vs theoretical 12.5 ng).
Benefits and practical applications
- Ultra-rapid digestion (sub-millisecond) dramatically shortens sample preparation time and supports high-throughput peptide mapping workflows compatible with automation.
- Reduced sample handling minimizes artifactual PTMs (e.g., oxidation) and sample loss, improving fidelity of CQA measurements.
- Iterative MS/MS during repeated automated injections enables deeper sequence coverage without extensive offline processing.
- Combination of targeted MS/MS fragment-ion monitoring and standard-addition absolute quantification provides robust and accurate measurement of PTMs and antibody concentration—suitable for development, comparability studies, and QC assays.
Future trends and potential applications
- Integration into regulated QC pipelines: further validation (precision, accuracy, robustness) can position microdroplet digestion LC/Q-TOF workflows as rapid alternatives for lot release or stability testing.
- Expanded PTM panels: multiplexed targeted MS/MS schemes could monitor additional CQAs (glycosylation variants, clipping, other oxidative or deamidative sites) in the same automated workflow.
- Automation and data processing: advanced acquisition strategies (real-time exclusion lists, iterative intelligent sampling) and dedicated data-analysis pipelines will enhance throughput and reduce manual interpretation.
- Transferability to other proteases and complex matrices: adapting microdroplet digestion for alternative proteases or for host-cell proteins and complex formulations could broaden applicability.
Conclusion
The reported online microdroplet trypsin digestion coupled with Agilent 6545XT AdvanceBio LC/Q-TOF achieves ultrafast proteolysis, high sequence coverage through iterative MS/MS, reliable PTM characterization (site-resolved deamidation and methionine oxidation), and accurate absolute antibody quantification using isotope-labeled standards. The approach reduces sample prep artifacts, supports automated flow-injection cycles (~2-minute routines), and offers a compelling workflow for accelerated antibody characterization in research and biopharma environments.
References
- Zhong, X.; Chen, H.; Zare, R. N. Ultrafast Enzymatic Digestion of Proteins by Microdroplet Mass Spectrometry. Nat. Commun. 2020, 11, 1049.
- Andrade, J. M.; Terán‑Baamonde, J.; Soto‑Ferreiro, R. M.; Carlosena, A. Interpolation in the Standard Additions Method. Anal. Chim. Acta 2013, 780, 13–19.
- Gunawardena, H. P.; Ai, Y.; Gao, J.; Zare, R. N.; Chen, H. Rapid Characterization of Antibodies via Automated Flow Injection Coupled with Online Microdroplet Reactions and Native‑pH Mass Spectrometry. Anal. Chem. 2023, 95(6), 3340–3348.
- Xiao, M.; Yang, Y.; Schladebeck, A.; Lau, J.; Knierman, M.; Zhao, H.; Qiu, X.; Luo, K.; Gunawardena, H. P.; Chen, H. Rapid Antibody Structural Characterization and Quantification via Microdroplet Trypsin Digestion. J. Am. Soc. Mass Spectrom. 2026. [online ahead of print]
- Gao, X.; Ji, J. A.; Veeravalli, K.; Wang, Y.; Zhang, T.; McGreevy, W.; Zheng, K.; Kelley, R. F.; Laird, M. W.; Liu, J.; et al. Effect of Individual Fc Methionine Oxidation on FcRn Binding. J. Pharm. Sci. 2015, 104(2), 368–377.
- Dau, T.; Bartolomucci, G.; Rappsilber, J. Proteomics Using Protease Alternatives to Trypsin Benefits from Sequential Digestion with Trypsin. Anal. Chem. 2020, 92(14), 9523–9527.
- Mouchahoir, T.; Schiel, J. E. Development of an LC‑MS/MS Peptide Mapping Protocol for the NISTmAb. Anal. Bioanal. Chem. 2018, 410(8), 2111–2126.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
Characterization of IgG1 monoclonal antibody (mAb) oxidation variants at intact, subunit and peptide levels
2020|Thermo Fisher Scientific|Applications
APPLICATION BRIEF 73555 Characterization of IgG1 monoclonal antibody (mAb) oxidation variants at intact, subunit and peptide levels Authors: Sara Carillo and Jonathan Bones NIBRT – The National Institute for Bioprocessing Research and Training, Dublin, Ireland [email protected] Tom Buchanan, Kristina Srzentic…
Key words
ipilimumab, ipilimumaboxidation, oxidationhotspots, hotspotsstressed, stressedisr, isrmass, massnibrt, nibrtdtlmisr, dtlmisrrelative, relativecontrol, controlthermo, thermoscientific, scientificpinpoint, pinpointunmodified, unmodifiedlocalization
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Key words
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionmodifications, modificationssequence, sequencerelative, relativemapping, mappingdigest, digestscientific, scientificterminal, terminalptms, ptmsoptima, optimaabundance
In-depth Peptide Mapping of Monoclonal Antibody (mAb) by A de novo Peptide Sequencing Method on Q-TOF Mass Spectrometer with Data-independent Acquisition
2019|Shimadzu|Applications
Application News No. AD-0217 Biopharma / LCMS-9030 (Q-TOF) In-depth Peptide Mapping of Monoclonal Antibody (mAb) by A de novo Peptide Sequencing Method on Q-TOF Mass Spectrometer with Data-independent Acquisition Yonghai Lu and Zhaoqi Zhan Application Development & Support Centre, Shimadzu…
Key words
peptide, peptidedia, diamab, mabnovo, novomapping, mappingbevacizumab, bevacizumabchain, chainsequencing, sequencingalpapiek, alpapiekpeptides, peptidestryptic, trypticnews, newsdial, dialmonoclonal, monoclonalheavy