Automated LC/MS System Readiness Assessment for MAM Using Purpose Designed Peptide Standards

Posters | 2026 | Agilent Technologies | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/TOF, LC/HRMS
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Importance of the Topic


The robustness and reproducibility of LC/MS systems are critical for Multi-Attribute Method (MAM) workflows used in biopharmaceutical development and QC. Reliable verification of mass accuracy, retention time stability and detector response prior to sample injection prevents wasted run time, reduces risk to valuable samples and supports regulatory expectations for consistent method performance. An automated, peptide‑based system readiness check replaces subjective manual reviews of complex digests with objective, documented pass/fail decisions, improving throughput and traceability.

Objectives and Study Overview


This study describes an automated LC/MS system readiness workflow tailored for MAM using a purpose‑designed 13‑peptide standard. The goals were to: provide reproducible, rapid verification of system performance across the MAM-relevant chromatographic window; detect common instrument stressors (oxidation, metal contamination, in‑source fragmentation, salt/adduct formation); and generate objective pass/fail readiness decisions within MAM software to streamline QC and development operations.

Used Methodology and Instrumentation


The approach uses a defined peptide mixture (Agilent 13‑peptide standard, nominally 1 pmol/µL, reconstituted in 200 µL of water with 1% formic acid and 5% acetonitrile) distributed across the analytical gradient to exercise the entire elution space of typical CQAs. Targeted feature extraction with predefined mass and retention time windows groups parent peptides with related molecular species (isotopologues, adducts, in‑source fragments) and computes readiness metrics automatically.

Key LC conditions and consumables:
  • Column: AdvanceBio Peptide Mapping C18, 2.1 × 150 mm
  • Mobile phases: A = water + 0.1% FA; B = ACN + 0.1% FA
  • Gradient: 2% B initial; ramp to 35% at 20 min; wash to 80% then reequilibration (total runtime ≈27 min)
  • Flow: 0.4 mL/min; Column temp: 50 °C

Mass spectrometry (Agilent G6230C and Jet Stream ESI) settings included positive polarity, m/z 200–2200 scan range, acquisition rate 3, fragmentor 45 V, skimmer 35 V, capillary 3000 V, drying and sheath gas flows and temperatures as specified for stable ESI operation.

Diagnostic peptides and targeted stressors:
  • Oxidation: DTLMISR / DTLM(oxy)ISR
  • Deamidation and resolution: VVSVLTVLHQDWLNGK / VVSVLTVLHQDWLDGK
  • Isotopic/dynamic range check: ALPAPIEK / ALPAPIEK* (Lys‑13C6,15N2)
  • Metal affinity and salt/contamination indicators: VLQPGYLEVDY / VLQPGYLEVDY+Fe and SNFR / SNFR+Na
  • In‑source fragmentation probe (fragile peptide): ALELFR and its y‑ions

Main Results and Discussion


The automated workflow successfully extracted targeted peptide features and computed grouped metrics without manual intervention. Representative outcomes included:
  • In‑source fragmentation: For ALELFR at 2 pmol on column, extracted ion chromatograms showed parent [M+H]+ and [M+2H]2+ signals with negligible y‑type fragment peaks; automated fragment:parent area ratios confirmed minimal fragmentation under the evaluated conditions.
  • Deamidation and chromatographic resolution: The deamidation pair at 1 pmol on column produced well‑resolved peaks and reproducible feature extraction. The automated deamidation ratio was evaluated against a predefined acceptance window (4–8%), supporting an objective pass/fail decision.
  • Oxidation monitoring: DTLMISR and oxidized species (+1/+2 charge states) measured at 2 pmol were grouped to compute oxidized:parent ratios; automated comparison to criteria enabled tracking of system‑related oxidation stress.
  • Dynamic range: The isotopically labeled pair ALPAPIEK/ALPAPIEK* at 4 pmol demonstrated adequate MS dynamic range and consistent peak area ratios, validating instrument linearity across relevant concentrations.
  • Mass accuracy, retention time stability and peak area precision: Across diagnostic peptides the workflow reported reproducible mass accuracy (ppm), low RT drift and acceptable %RSD for peak area, consistent with a fit‑for‑purpose decision for MAM runs.

The software's automated grouping of related molecular species reduced subjectivity and manual calculation errors; it also enabled rapid SPC‑style pass/fail outputs and archival of system readiness evidence.

Benefits and Practical Applications


Practical advantages of this peptide‑based automated readiness assessment include:
  • Objective and reproducible evaluation of LC/MS performance prior to MAM sample analysis.
  • Faster turnaround compared to complex protein digest checks and reduced analyst variability.
  • Targeted detection of common instrument stressors (oxidation, metal contamination, salts/adducts, in‑source fragmentation) that directly impact CQA measurement.
  • Automated pass/fail decisions and metric reporting that facilitate documentation for QC and regulatory traceability.
  • Scalable implementation across laboratories using standardized peptide panels and embedded software rules.

Future Trends and Potential Uses


Potential extensions and developments that would enhance readiness assessment utility include:
  • Expanded and modular peptide panels to cover additional modification types and chromatographic chemistries.
  • Real‑time or near‑real‑time monitoring integrated with instrument control and automatic alerts when metrics trend toward failure.
  • Integration with LIMS and electronic protocols to automate sample gating, audit trails and release decisions.
  • Cloud‑based analytics and machine learning for anomaly detection, predictive maintenance and cross‑lab performance benchmarking.
  • Standardization initiatives and cross‑vendor peptide standards to support broader regulatory acceptance of automated readiness workflows.

Conclusion


The described automated LC/MS system readiness workflow using a defined 13‑peptide standard provides a practical, objective and efficient mechanism to verify instrument fitness for MAM. By combining targeted feature extraction, diagnostic peptide grouping and predefined acceptance criteria, laboratories can reduce subjective review, increase throughput and produce documented pass/fail decisions that support robust biopharmaceutical analysis.

Reference


  1. Nature Protocols. 17, 3565–3603 (year not specified).
  2. Rogers RS, et al. mAbs. 2015;7(5):881–890.
  3. Rogstad S, et al. Analytical Chemistry. 2019;91(22):14170–14177.
  4. Yang X, et al. mAbs. 2023;15:2197668.
  5. Millán‑Martín S, et al. Nature Protocols. 2023;18:1056–1089.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Advancing Chromatographic Performance in Peptide Mapping
Advancing Chromatographic Performance in Peptide Mapping
2025|Agilent Technologies|Applications
Application Note Biopharma Advancing Chromatographic Performance in Peptide Mapping Using the Agilent Altura ZORBAX Eclipse Plus C18 inert column Authors Abstract Jordy Hsiao, Mahsan Miladi, Li Gu, Stephen Sciuto, Guannan Li, and Anne Blackwell Agilent Technologies, Inc. This study highlights…
Key words
altura, alturadeamidated, deamidatedvvsvltvlhqdwlngk, vvsvltvlhqdwlngkcounts, countsalpapiek, alpapiekpeptide, peptidevvsvltvlhqdwldgk, vvsvltvlhqdwldgkacquisition, acquisitiondtlmisr, dtlmisrinert, inertmapping, mappingcharge, chargecolumn, columnherceptin, herceptintrypsin
Ultrafast Antibody Peptide Mapping with the Agilent 6545XT AdvanceBio LC/Q-TOF
Technical Overview Ultrafast Antibody Peptide Mapping with the Agilent 6545XT AdvanceBio LC/Q-TOF Authors Introduction Mengyuan Xiao, Yongqing Yang, Andrew Schladebeck, and Hao Chen Department of Chemistry & Environmental Science, New Jersey Institute of Technology, Newark, NJ, 07102, USA This technical…
Key words
microdroplet, microdropletdeamidation, deamidationnist, nistantibody, antibodydigestion, digestionmab, mabheavy, heavydtlmisr, dtlmisrquantification, quantificationdtlm, dtlmpeptide, peptideonline, onlinestressed, stressedlight, lightoxidation
Multi-Attribute Methods for Biopharmaceutical Analysis
[ APPLICATION NOTEBOOK ] Multi-Attribute Methods for Biopharmaceutical Analysis Application Notes [ APPLICATION NOTEBOOK ] Introduction The adoption of LC-MS-based multi-attribute method (MAM) analysis for routine monitoring of biotherapeutic variation has progressed greatly over the last five years. The ability…
Key words
notebook, notebookattribute, attributebiopharmaceutical, biopharmaceuticalreturn, returnmulti, multimam, mamapplication, applicationcontents, contentspeptide, peptideattributes, attributesmethods, methodsacquity, acquitymab, mabbioaccord, bioaccordmonitoring
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY Nilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin Chen Waters Corporation, 34 Maple street, MA, 01757, USA INTRODUCTION  The Peptide Multi-Attribute Method…
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngksuccinamide, succinamidebioaccord, bioaccordpremier, premieroxidation, oxidationpennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngq, gfypsdiavewesngqacquity, acquitymam, mamvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike