Comprehensive characterization of oligonucleotides and related impurities using advanced LC/Q-TOF analytical workflows

Posters | 2026 | Agilent Technologies | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/TOF, LC/HRMS, 2D-LC
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Importance of the topic

Therapeutic oligonucleotides are an expanding class of modalities with sequence-specific biological activity but substantial structural heterogeneity. Robust impurity profiling is essential for safety, efficacy and regulatory compliance because common manufacturing- and storage-related variants (backbone modifications, truncations/extensions, depurination, abasic sites, and PS→PO conversions) can alter pharmacology and immunogenicity. Advanced analytical workflows that combine high-resolution chromatography and accurate-mass MS enable characterization of both major product and low-level related impurities that often coelute in conventional one-dimensional LC/MS methods.

Objectives and overview of the study

This study demonstrates a comprehensive 2D-LC/MS workflow to characterize nusinersen (an antisense oligonucleotide, ~7.127 kDa) and its related impurities. Goals were to (1) resolve coeluting isoforms and low-abundance variants, (2) provide MS and MS/MS-based sequence confirmation of full-length product (FLP) and truncated/modified species, and (3) improve sensitivity through MS-compatible desalting in a second dimension while maintaining throughput via multi-heart-cut/high-resolution sampling.

Methodology

The workflow uses orthogonal two-dimensional LC with targeted multiple-heart-cut (MHC) transfers into a desalting/analytical 2D column followed by accurate-mass Q-TOF detection and automated sequence confirmation.
  • First-dimension separation: ion-pairing reversed-phase (Altura Oligo HPH-C18) using dibutylamine/HFIP-containing buffer to maximize chromatographic resolution of sequence and backbone isomers.
  • Second-dimension desalting/separation: HILIC-Z (Altura Poroshell) with ammonium acetate-based mobile phase to provide MS-compatible conditions and enhance sensitivity for transferred heart-cuts.
  • Sampling strategy: HiRes sampling combined with a multi-inject approach (biocompatible loops emulating large loop volumes) to transfer multiple heart-cuts per run, improving throughput while preserving high 1D separation fidelity.
  • MS acquisition and data processing: Agilent 6545XT AdvanceBio Q-TOF operated in negative ion mode with wide mass range (m/z ~400–3,200) and MS/MS collection. MassHunter BioConfirm software was used for Target+Impurities and Sequence Confirmation workflows with tolerances set typically to ±10 ppm for MS and ±20 ppm for MS/MS.

Used instrumentation

  • Agilent 1290 Infinity III Bio 2D-LC platform (flexible and high-speed pumps, multisampler, multicolumn thermostat, diode-array/UV detectors) configured for MHC 2D operation.
  • Columns: Altura Oligo HPH-C18 (4.6 × 150 mm, 2.7 μm) for 1D; Altura Poroshell HILIC-Z (2.1 × 100 mm, 2.7 μm) for 2D.
  • Mass spectrometer: Agilent 6545XT AdvanceBio LC/Q-TOF. Representative MS settings included source gas temperatures ~250–350 °C, drying and sheath gas flows ~12–13 L/min, VCap ~4,500 V, nozzle ~2,000 V, fragmentor ~180 V, and negative-mode acquisition.
  • Software: MassHunter BioConfirm for automated sequence annotation, impurity detection and MS/MS-based confirmation.

Main results and discussion

  • The 2D-LC approach effectively separated coeluting species that were unresolved in 1D runs. Heart-cut transfers of the 1D peak region containing the FLP and coeluting impurities enabled their chromatographic resolution on the HILIC-Z 2D column.
  • Mass spectra and MS/MS fragmentation ladders (y, b and w ions) allowed unambiguous identification of the FLP and multiple truncated variants (e.g., N-1 truncations) and chemical variants such as phosphorothioate (PS) to phosphodiester/PO conversions. MS/MS fragmentation patterns localized modifications and termini-specific changes (5′/3′ signatures).
  • HiRes multi-inject sampling transferred multiple targeted heart-cuts (e.g., 10 heart-cuts per run) improving throughput while enabling high-resolution MS characterization of trace-level peaks across the chromatogram.
  • Mass accuracy and MS/MS data quality from the 6545XT provided confident identifications of low-abundance impurities; automated BioConfirm workflows streamlined matching observed masses/fragment ions to expected sequences with defined mass tolerances.

Benefits and practical applications of the method

  • Enhanced impurity detection: Orthogonal 2D separations plus MS-compatible desalting improve signal-to-noise and permit detection/confirmation of low-level sequence variants and chemical degradants.
  • Regulatory relevance: The approach supports impurity profiling required for GMP and therapeutic development by delivering sequence-level evidence for product-related and process-related variants.
  • Throughput and flexibility: Multi-heart-cut and multi-inject strategies preserve 1D resolution while increasing sample throughput and enabling targeted analysis of regions of interest without hardware modification.
  • Automated data interpretation: BioConfirm workflows reduce manual annotation time and provide reproducible criteria for sequence confirmation and impurity assignment.

Future trends and possibilities for application

  • Increased automation and standardized 2D-LC/MS methods for routine GMP release and stability testing of oligonucleotide therapeutics.
  • Integration with ion mobility spectrometry to add an additional orthogonal separation dimension for isomeric/isobaric species.
  • Higher-resolution and faster MS platforms to push limits of detection for ultra-trace impurities and enable more extensive MS/MS mapping of modifications.
  • Improved software workflows incorporating machine learning for deconvolution of complex charge envelopes and automated localization of chemical modifications.
  • Expansion toward quantitative 2D-LC/MS methods and validated impurity assays for regulated environments, and adoption for novel modalities such as siRNA, gapmers and conjugated oligonucleotides.

Conclusion

The presented 2D-LC/MS workflow combining ion-pair RP 1D separations with HILIC-Z MS-compatible 2D desalting, multi-heart-cut sampling and accurate-mass Q-TOF detection provides a practical, high-resolution platform for comprehensive characterization of oligonucleotide therapeutics. The approach resolves coeluting isoforms, identifies truncations and backbone modifications by MS/MS, and increases sensitivity for low-abundance impurities while maintaining throughput through multi-inject strategies. Coupling robust chromatographic design with automated sequence-confirmation software delivers a scalable solution for development and quality control of oligonucleotide drugs.

Reference

Agilent Technologies. Analysis of GLP-1 Agonists Using the Agilent 1290 Infinity II Bio LC System and Altura Ultra Inert HPLC Column. Agilent publication number 5994-8837EN, 2025.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Advanced Characterization of Semaglutideand Its Impurities Using a Heart-Cutting 2D-LC/MS Workflow for Biopharmaceutical Analysis
Poster Reprint ASMS 2025 Poster number TP 638 Advanced Characterization of Semaglutide and Its Impurities Using a Heart-Cutting 2D-LC/MS Workflow for Biopharmaceutical Analysis Tanya Jones1, Paramjeet Khandpur2 , Ashish Pargaonkar2, Preeti Bharatiya2 1Agilent Technologies, Inc. Raleigh, NC 2Agilent Technologies, Inc.…
Key words
bioconfirm, bioconfirmhires, hiressemaglutide, semaglutidetemp, tempflowrate, flowrateimpurities, impuritiesmain, mainmultiinject, multiinjectlateeluting, lateelutingsampling, samplingfocused, focuseddimension, dimensioncolumn, columnmodifications, modificationsemulating
Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities
Application Note Biopharma/Pharma Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities Using an Agilent 1290 Infinity III bio 2D-LC and an Agilent 6545XT AdvanceBio LC/Q-TOF Authors Abstract Paramjeet Khandpur, Preeti Bharatiya, and Ashish Pargaonkar Agilent Technologies, Inc.…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgimpurities, impuritiespeptide, peptideaegtftsdvssylegqaakefiawlvrgrg, aegtftsdvssylegqaakefiawlvrgrgsequence, sequenceimpurity, impurityadvancebio, advancebiomass, massacquisition, acquisitionmodifications, modificationstruncated, truncatedpeptides, peptidesmhc, mhcseparation
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
High-Resolution Sampling 2D-LC for Pharmaceutical Impurity Analysis
High-Resolution Sampling 2D-LC for Pharmaceutical Impurity Analysis Detection of Impurities Hidden Under the API Peak at Relevant Levels Application Note Small Molecule Pharmaceuticals and Generics Authors Abstract Susanne Stephan and Sonja Krieger The analysis of impurities in low concentrations relative…
Key words
chlorodifluorobenzoic, chlorodifluorobenzoicdimension, dimensionwaste, wasteinsulin, insulinhdr, hdrtime, timediverter, diverterdad, dadimpurities, impuritiesdiode, diodeimpurity, impuritycuts, cutssampling, samplingarray, arrayfirst
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike