High-throughput peptide mapping of trastuzumab using a tandem LC-MS workflow
Applications | 2020 | Thermo Fisher ScientificInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesPharma & Biopharma, Proteomics
ManufacturerThermo Fisher Scientific
Key wordsmapping, tandem, duo, peptide, workflow, mam, idle, ptms, vanquish, uhplc, system, throughput, thermo, analysis, modification, digest, abundance, rsd, monoclonal, subunit, gradient, two, trastuzumab, attribute, avg, instrument, scientific, trypsin, tryptic, across, considering, retention, pumps, therapeutic, antibody, smart, excellent, digestion, relative, acquisition, accomplishes, performed, lag, correct, kingfisher, nibrt, using, returning, setup, high
Similar PDF
SMART Digest Peptide Mapping and Quantitation Compendium
2018|Thermo Fisher Scientific|Guides
Table of Contents Introduction Faster and More Sensitive Protein Characterization and Quantitation Easier Digestion Faster Digestion Highly Reproducible Digestion Automation of Digestion Improving Sensitivity and Speed SMART Digest Peptide Mapping and Quantitation Compendium Peptide Mapping Peptide Quantitation Product and Method…
Key words
mapping, mappingpeptide, peptidedigestion, digestionsmart, smartmodifications, modificationsdigest, digestchain, chainposttranslational, posttranslationalheavy, heavymonoclonal, monoclonalantibodies, antibodiestrypsin, trypsinthroughput, throughputautomated, automatedprotein
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duoprime, primemagnetic, magneticadalimumab
Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21782 Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Noemi Dorival-García, Nicola McGillicuddy, Sara Carillo, Amy Farrell, Jonathan Bones National Institute for Bioprocessing…
Key words
smart, smartdigest, digestadalimumab, adalimumabdigestion, digestionmagnetic, magneticmodifications, modificationsalternative, alternativepeptide, peptiderapid, rapidmapping, mappingdeamidation, deamidationrelative, relativenistmab, nistmabinduced, inducedsample
Accelerating monoclonal antibody peptide mapping with high acquisition speed Orbitrap-based MS
2020|Thermo Fisher Scientific|Applications
APPLICATION NOTE 73672 Accelerating monoclonal antibody peptide mapping with high acquisition speed Orbitrap-based MS Authors: Phil Widdowson, Amy Claydon, Tom Buchanan Thermo Fisher Scientific, Hemel Hempstead, UK Keywords: Peptide mapping, monoclonal antibody, mAb, post-translational modification, PTM, high throughput analysis, golimumab,…
Key words
golimumab, golimumabterminal, terminaldeamidation, deamidationglycosylation, glycosylationpeptide, peptidelysine, lysinemodification, modificationmapping, mappingdigest, digestrelative, relativepeptides, peptidesoxidation, oxidationmodifications, modificationssmart, smartglycopeptide