Accelerating monoclonal antibody peptide mapping with high acquisition speed Orbitrap-based MS
Applications | 2020 | Thermo Fisher ScientificInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Key wordsgolimumab, terminal, deamidation, glycosylation, peptide, lysine, modification, mapping, digest, relative, oxidation, peptides, pyroglu, smart, modifications, glycopeptide, digestion, glycan, ptms, heterogeneity, pyroglutamate, vanquish, oxydization, terminus, tryptic, thermo, orbitrap, chain, asu, buffer, primarily, biopharma, scientific, sequence, length, exploris, cyclization, final, abundance, coverage, high, gradient, isoaspartic, mass, oxidized, were, both, acquisition, site, methionine
Similar PDF
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duoprime, primemagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Key words
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionsequence, sequencemodifications, modificationsrelative, relativemapping, mappingscientific, scientificterminal, terminaldigest, digestptms, ptmsoptima, optimaabundance
SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
2016|Thermo Fisher Scientific|Applications
APPLICATION NOTE Authors: Martin Samonig1, Alexander Schwahn2, Ken Cook3, Mike Oliver4, and Remco Swart1 Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Basel, Switzerland; 3Thermo Fisher Scientific, Hemel Hempstead, United Kingdom; 4 Thermo Fisher Scientific, Runcorn, United Kingdom 1 Key…
Key words
smart, smartdigest, digestdigestion, digestiondeamidation, deamidationurea, ureamodifications, modificationscarbamylation, carbamylationpeptide, peptiderituximab, rituximabmodification, modificationrelative, relativeabundance, abundanceheat, heatscientific, scientificthermo
SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
2016|Thermo Fisher Scientific|Applications
APPLICATION NOTE Authors: Martin Samonig1, Alexander Schwahn2, Ken Cook3, Mike Oliver4, and Remco Swart1 Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Basel, Switzerland; 3Thermo Fisher Scientific, Hemel Hempstead, United Kingdom; 4 Thermo Fisher Scientific, Runcorn, United Kingdom 1 Key…
Key words
smart, smartdigest, digestdigestion, digestiondeamidation, deamidationurea, ureamodifications, modificationscarbamylation, carbamylationpeptide, peptiderituximab, rituximabmodification, modificationrelative, relativeabundance, abundanceheat, heatscientific, scientificthermo