Accelerating monoclonal antibody peptide mapping with high acquisition speed Orbitrap-based MS
Applications | 2020 | Thermo Fisher ScientificInstrumentation
Monoclonal antibodies represent a dominant class of biotherapeutics with significant therapeutic impact and commercial importance. Fast and reliable peptide mapping is critical for confirming amino acid sequence, identifying post-translational modifications (PTMs) and ensuring consistent product quality throughout development and manufacturing. High-throughput methods that maintain comprehensive sequence coverage and PTM characterization enable rapid process optimization and support quality control.
This study demonstrates the capabilities of the Thermo Scientific™ Orbitrap Exploris™ 480 mass spectrometer coupled with a Vanquish™ UHPLC system for rapid, high-resolution peptide mapping of the therapeutic antibody golimumab. By employing shortened chromatographic gradients (5–40 minutes) and automated sample preparation, the work aims to maintain 100% sequence coverage, detect and quantify key PTMs, and illustrate the method’s applicability to process development and high-throughput screening.
Golimumab samples were subjected to forced oxidation (500 ppm H2O2, 24 h) or analyzed in their native state. Automated digestion was performed using SMART Digest™ magnetic resin and a Thermo Scientific™ KingFisher™ Duo Prime system controlled by BindIt™ software. Peptides were separated on an Acclaim™ VANQUISH™ C18 column (2.1 × 250 mm) using the Vanquish Horizon UHPLC platform under gradients from 5 to 40 min (2–40% acetonitrile in 0.1% formic acid). Data were acquired on the Orbitrap Exploris 480 (MS1 resolution 60 000, data-dependent MS2 Top15 at 15 000) and processed using Chromeleon™ 7.2 CDS and BioPharma Finder™ 3.2 software.
Peptide mapping across all gradients achieved 100% sequence coverage for both heavy and light chains, even with a 5-minute separation. Key PTMs were consistently identified and quantified:
Further enhancements may include:
The combination of the Orbitrap Exploris 480 mass spectrometer and Vanquish UHPLC system delivers rapid, high-throughput peptide mapping without compromising sequence coverage or PTM characterization. This robust workflow, supported by automated digestion and compliance-ready software, is well suited for biopharmaceutical process development, quality control, and biosimilar comparability studies.
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Summary
Importance of the Topic
Monoclonal antibodies represent a dominant class of biotherapeutics with significant therapeutic impact and commercial importance. Fast and reliable peptide mapping is critical for confirming amino acid sequence, identifying post-translational modifications (PTMs) and ensuring consistent product quality throughout development and manufacturing. High-throughput methods that maintain comprehensive sequence coverage and PTM characterization enable rapid process optimization and support quality control.
Objectives and Overview
This study demonstrates the capabilities of the Thermo Scientific™ Orbitrap Exploris™ 480 mass spectrometer coupled with a Vanquish™ UHPLC system for rapid, high-resolution peptide mapping of the therapeutic antibody golimumab. By employing shortened chromatographic gradients (5–40 minutes) and automated sample preparation, the work aims to maintain 100% sequence coverage, detect and quantify key PTMs, and illustrate the method’s applicability to process development and high-throughput screening.
Methodology
Golimumab samples were subjected to forced oxidation (500 ppm H2O2, 24 h) or analyzed in their native state. Automated digestion was performed using SMART Digest™ magnetic resin and a Thermo Scientific™ KingFisher™ Duo Prime system controlled by BindIt™ software. Peptides were separated on an Acclaim™ VANQUISH™ C18 column (2.1 × 250 mm) using the Vanquish Horizon UHPLC platform under gradients from 5 to 40 min (2–40% acetonitrile in 0.1% formic acid). Data were acquired on the Orbitrap Exploris 480 (MS1 resolution 60 000, data-dependent MS2 Top15 at 15 000) and processed using Chromeleon™ 7.2 CDS and BioPharma Finder™ 3.2 software.
Instrumentation Used
- Vanquish Horizon UHPLC system with Binary Pump H, Sampler HT and Column Compartment H
- Acclaim VANQUISH C18, 2.2 µm, 2.1 × 250 mm column
- Orbitrap Exploris 480 mass spectrometer with BioPharma option
- SMART Digest magnetic trypsin kit and KingFisher™ 96 Deepwell plate
- Chromeleon™ 7.2.10 CDS and BioPharma Finder™ 3.2 software
Main Results and Discussion
Peptide mapping across all gradients achieved 100% sequence coverage for both heavy and light chains, even with a 5-minute separation. Key PTMs were consistently identified and quantified:
- Oxidation at methionine sites (M261 ~100%, M437 ~50%) and lower-abundance sites (M51, M113)
- Deamidation and succinimide formation at N43 (~60% Asn→Asp, ~10% Asu) and low-abundance deamidation at N370
- N-terminal pyroglutamate conversion of HC Q1 (~100%) and absent at LC E1
- C-terminal lysine clipping (~15–20%) evidenced by distinct charge states and retention times
- N-linked glycosylation profile at N306 featuring G0F (~38–43%), G1F (~34–39%), G2F (~9–11%) and minor high-mannose species
Benefits and Practical Applications of the Method
- Shortened analysis times increase throughput for process support and clone or media screening
- Automated digestion and data acquisition ensure reproducibility and reduce hands-on time
- High-resolution, fast scan performance preserves data quality in rapid UHPLC separations
- Comprehensive PTM profiling supports critical quality attribute monitoring during development
Future Trends and Potential Applications
Further enhancements may include:
- Integration of multiplexed or multiplex-augmentation strategies to analyze several samples simultaneously
- Advanced AI-driven data analysis for accelerated PTM discovery and trend prediction
- Expanded workflows for deeper glycan characterization using complementary hydrophilic separations
- Real-time process analytical technology (PAT) applications for in-line monitoring during bioreactor runs
Conclusion
The combination of the Orbitrap Exploris 480 mass spectrometer and Vanquish UHPLC system delivers rapid, high-throughput peptide mapping without compromising sequence coverage or PTM characterization. This robust workflow, supported by automated digestion and compliance-ready software, is well suited for biopharmaceutical process development, quality control, and biosimilar comparability studies.
References
- Evaluate Pharma World Preview 2018, Outlook to 2024.
- Wang W. et al., Mol. Immunol., 2011, 48, 806–866.
- Guan Z. et al., JASMS, 2003, 14, 605–613.
- Haberger M. et al., mAbs, 2014, 6(2), 327–339.
- Goetze A. M. et al., Glycobiology, 2011, 21(7), 949–959.
- Hossler P. et al., Glycobiology, 2009, 19(9), 936–949.
- Huang K. F. et al., PNAS, 2005, 102(37), 13117–13122.
- Dick L. W. Jr. et al., Biotechnol. Bioeng., 2007, 97(3), 544–553.
- Liu Z. et al., J. Pharm. Sci., 2019, 108(10), 3194–3200.
- Beyer B. et al., Biotechnol. J., 2018, 13, 1700476.
- Brorson K. and Jia A. Y., Curr. Opin. Biotechnol., 2014, 29, 140–146.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Key words
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionmodifications, modificationssequence, sequencerelative, relativemapping, mappingdigest, digestscientific, scientificterminal, terminalptms, ptmsoptima, optimaabundance
SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
2016|Thermo Fisher Scientific|Applications
APPLICATION NOTE Authors: Martin Samonig1, Alexander Schwahn2, Ken Cook3, Mike Oliver4, and Remco Swart1 Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Basel, Switzerland; 3Thermo Fisher Scientific, Hemel Hempstead, United Kingdom; 4 Thermo Fisher Scientific, Runcorn, United Kingdom 1 Key…
Key words
smart, smartdigest, digestdigestion, digestiondeamidation, deamidationurea, ureamodifications, modificationscarbamylation, carbamylationrituximab, rituximabpeptide, peptideabundance, abundancemodification, modificationrelative, relativeheat, heatscientific, scientificsolution
SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
2016|Thermo Fisher Scientific|Applications
APPLICATION NOTE Authors: Martin Samonig1, Alexander Schwahn2, Ken Cook3, Mike Oliver4, and Remco Swart1 Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Basel, Switzerland; 3Thermo Fisher Scientific, Hemel Hempstead, United Kingdom; 4 Thermo Fisher Scientific, Runcorn, United Kingdom 1 Key…
Key words
smart, smartdigest, digestdigestion, digestiondeamidation, deamidationurea, ureamodifications, modificationscarbamylation, carbamylationrituximab, rituximabpeptide, peptideabundance, abundancerelative, relativemodification, modificationheat, heatscientific, scientificthermo