How to Maximize Bioanalytical Performance of Fc-Fusion Proteins: Practical Sample Preparation and LC-MS/MS Workflows for Dulaglutide Quantification from Plasma
Applications | 2020 | WatersInstrumentation
Sample Preparation, Consumables, LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordshgegtftsdvssyleeqaak, glpssiek, dulaglutide, proteinworks, peptide, lqc, accuracy, hgeg, rsd, hqc, lloq, digestion, uplc, statistics, express, hmqc, superblock, affinity, glps, lmqc, peptides, note, acquity, digest, capture, spe, application, protein, auto, biotinylated, surrogate, quanrecovery, xevo, mqc, mcx, quantification, curve, plus, beads, oasis, rat, optimization, preparation, dpevqfnwyvdgvevhnaktkpreeqfnstyr, eskygppcppcpapeaa, ggpsvflfppkpkdtlmisrtpevtcvvvdvsqe, ggsggggsggggsa, gsfflysrltvdksrwqegnvfscsvmhealhn, hgegtftsdvssyleeqaakefiawlvkggggg, hytqkslslslg
Similar PDF
Accurate and Sensitive LC-MS/MS Quantification of Adalimumab in Serum/Plasma: Impact of Sample Preparation on Method Performance
2018|Waters|Applications
[ APPLICATION NOTE ] Accurate and Sensitive LC-MS/MS Quantification of Adalimumab in Serum/Plasma: Impact of Sample Preparation on Method Performance Caitlin Dunning, Mary Lame, Steven Calciano, and Kelly Doering Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ Speed and…
Key words
adalimumab, adalimumabserum, serumglewvsaitwnsghidyadsvegr, glewvsaitwnsghidyadsvegrquantification, quantificationnylawyqqkpgk, nylawyqqkpgkproteinworks, proteinworksapytfgqgtk, apytfgqgtkplasma, plasmaprotein, proteinspe, spepeptide, peptideaccurate, accuratedigestion, digestiondigest, digestsensitive
Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion
2019|Waters|Applications
[ APPLICATION NOTE ] Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion Paula Orens and Mary Lame Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automating a hybrid LC-MS/MS…
Key words
protein, proteinautomating, automatingbioanalysis, bioanalysistherapeutics, therapeuticshybrid, hybridautomated, automatedworkflows, workflowsictcrpgwycalsk, ictcrpgwycalskimmunoaffinity, immunoaffinitypreparation, preparationpurification, purificationetanercept, etanerceptmanual, manualnormalized, normalizedraw
Triple Quadrupole Mass Spectrometry (Xevo TQ-XS) for the Quantification of Monoclonal Antibody Light Chains in Plasma
2019|Waters|Applications
[ APPLICATION NOTE ] Triple Quadrupole Mass Spectrometry (Xevo TQ-XS) for the Quantification of Monoclonal Antibody Light Chains in Plasma Caitlin M. Dunning, Mary Lame, and Mark Wrona Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■ ■ Fast, reproducible, and…
Key words
chains, chainslight, lightquantification, quantificationadalimumab, adalimumabxevo, xevomab, mabmonoclonal, monoclonaltriple, tripleantibody, antibodypolyphenyl, polyphenylsubunit, subunitquadrupole, quadrupolebioresolve, bioresolvealkylation, alkylationplasma
Development of a Hybrid Immunoaffinity-LC-MS/MS Method for the Quantification of Active Biotherapeutics Targeting TNF-α in Serum
2018|Waters|Applications
[ APPLICATION NOTE ] Development of a Hybrid Immunoaffinity-LC-MS/MS Method for the Quantification of Active Biotherapeutics Targeting TNF-α in Serum Caitlin Dunning and Mary Lame Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ High analytical sensitivity Tumor Necrosis Factor…
Key words
infliximab, infliximabimmunoaffinity, immunoaffinitynylawyqqkpgk, nylawyqqkpgkadalimumab, adalimumabbiotherapeutics, biotherapeuticssinsathyaesvk, sinsathyaesvketanercept, etanercepttnf, tnfictcrpgwycalsk, ictcrpgwycalskquantification, quantificationserum, serumhybrid, hybridactive, activeapytfgqgtk, apytfgqgtkdilltqspailsvspger