Comparing an intrinsically disordered protein α-synuclein to fixed structure proteins following FPOP modification using high resolution LCMS intact analysis
Posters | 2020 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesProteomics
ManufacturerShimadzu
Key wordsfpop, idps, proteins, error, oxidative, fixed, oxidatively, synuclein, idp, protein, mass, deconvoluted, myoglobin, oxidation, modification, structure, lcms, intact, modified, intrinsically, evidence, lactoglobulin, photochemical, horse, theoretical, modify, ault, busuttil, goodfellow, gtvvltalggilkkkghheaelkplaqshatkh, kipikylefisdaiihvlhskhpgdfgadaqgam, lewy, lftghpetlekfdkfkhlkteaemkasedlkkh, sobott, tkalelfrndiaakykelgfqg, glsdgewqqvlnvwgkveadiaghgqevlir, jake, microsecond, hram, play, barnes, native, growing, loftus, disordered, enabling, role, aeris, signalling, deconvolution
Similar PDF
Identification of Oxidation Sites on a Monoclonal Antibody Using an Agilent 1260 Infinity HPLC-Chip/MS System Coupled to an Accurate-Mass 6520 Q-TOF LC/MS
2011|Agilent Technologies|Applications
Identification of Oxidation Sites on a Monoclonal Antibody Using an Agilent 1260 Infinity HPLC-Chip/MS System Coupled to an Accurate-Mass 6520 Q-TOF LC/MS Application Note Authors Abstract Ravindra Gudihal Agilent Technologies India Pvt. Ltd. Bangalore, India The identification of oxidation sites…
Key words
mab, maboxidation, oxidationoxidized, oxidizedntlylq, ntlylqsslr, sslrpeptide, peptidetrypsin, trypsinmonoclonal, monoclonalmass, masstheoretical, theoreticalmsslr, msslrbioconfirm, bioconfirmantibody, antibodyntlylqmsslr, ntlylqmsslrsequence
Analysis of Proteins and Peptides using LC-MS
|Shimadzu|Applications
LAAN-A-LM-E012 SHIMADZU APPLICATION NEWS ● LIQUID CHROMATOGRAPHY MASS SPECTROMETRY No. C55 Analysis of Proteins and Peptides using LC-MS important process, and this is currently conducted using such technologies as peptide sequencing for amino acid analysis, HPLC for simple peptide mapping,…
Key words
cdl, cdlweight, weightvoltage, voltagemolecular, molecularmultiply, multiplyamino, aminopeptides, peptidespeptide, peptidenews, newsmass, masssequence, sequenceenzymatic, enzymaticylefisdaiihvlhskhpgdfgadaqgamtk, ylefisdaiihvlhskhpgdfgadaqgamtkglsdgewqqvlnvwgkveadiaghgqevlir, glsdgewqqvlnvwgkveadiaghgqevlircharged
Assessing key attributes of adeno-associated viral proteins using HPLC-FLD-intact mass analysis
2022|Thermo Fisher Scientific|Applications
Application note | 001120 Biopharma Assessing key attributes of adeno-associated viral proteins using HPLC-FLD-intact mass analysis Authors Application benefits Reiko Kiyonami1, Roberto Gamez1, Min • Rapid ratio assessment of adeno-associated virus (AAV) structural proteins VP1:VP2:VP3 through sensitive fluorescence detection •…
Key words
mass, massaav, aavtruncated, truncatedfld, fldviral, viralintact, intactintensity, intensitytheoretical, theoreticalrelative, relativeerror, errorppm, ppmsequence, sequenceobserved, observedprotein, proteinproteins
Top Down Milk Protein Identification and Relative Quantification by Q Exactive Mass Spectrometer
2013|Thermo Fisher Scientific|Posters
Top Down Milk Protein Identification and Relative Quantification by Q Exactive Mass Spectrometer Terry Zhang, David M. Horn, Charles Yang and Dipankar Ghosh Thermo Fisher Scientific, San Jose CA Overview Purpose: Mixtures of casein and whey proteins were characterized by…
Key words
casein, caseinwhey, wheyrylations, rylationsprotein, proteinforms, formsrylation, rylationproteins, proteinsprosightpc, prosightpclactalbumin, lactalbuminsequence, sequencetruncation, truncationons, onssubstantial, substantialmass, masscharacterized