Size Exclusion Chromatography- Based Identification of Liraglutide Oligomeric Forms
Applications | 2025 | Agilent TechnologiesInstrumentation
Liraglutide is a lipidated analog of the GLP-1 peptide hormone used in type 2 diabetes therapy. Its amphiphilic nature drives self-assembly into oligomers, impacting drug stability, efficacy, and safety. Accurate characterization of these oligomeric forms is critical for formulation development, quality control, and process optimization in biopharmaceutical manufacturing.
This study aimed to establish a robust size exclusion chromatography (SEC) workflow combined with UV detection and high-resolution mass spectrometry (LC/Q-TOF) to identify and quantify the oligomeric states of liraglutide under varying pH conditions. The method was optimized to reveal pH-dependent transitions and to monitor time-dependent changes in oligomer populations.
Sample Preparation
SEC/UV analysis revealed that at pH 6.4 liraglutide predominantly forms higher-order oligomers (~12-mer), while at pH 8.0 lower-order oligomers (~3-mer) dominate. Calibration with protein standards confirmed column performance and allowed approximate molecular weight estimation. SEC/MS data showed freshly prepared samples rich in low-order species; prolonged incubation produced detectable high-order oligomer peaks in the mass spectra. Deconvoluted mass data from the LC/Q-TOF enabled unambiguous assignment of oligomer masses, demonstrating a mixture of 2- to 15-mer assemblies.
This combined SEC/UV and SEC/MS approach provides:
Further developments may include integration of multi-angle light scattering or fluorescence detection for absolute molecular weight determination, real-time monitoring of oligomer dynamics during manufacturing, high-throughput screening of buffer and excipient effects, and application to other lipidated or self-assembling therapeutic peptides.
A robust SEC workflow employing the Agilent 1290 Infinity II bio LC and AdvanceBio SEC columns, coupled with LC/Q-TOF mass spectrometry, effectively characterizes pH-dependent oligomeric states of liraglutide. The method offers valuable insights for formulation design, stability assessment, and quality control in biopharmaceutical peptide development.
GPC/SEC, Consumables, LC columns, LC/HRMS, LC/TOF, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Importance of the Topic
Liraglutide is a lipidated analog of the GLP-1 peptide hormone used in type 2 diabetes therapy. Its amphiphilic nature drives self-assembly into oligomers, impacting drug stability, efficacy, and safety. Accurate characterization of these oligomeric forms is critical for formulation development, quality control, and process optimization in biopharmaceutical manufacturing.
Objectives and Study Overview
This study aimed to establish a robust size exclusion chromatography (SEC) workflow combined with UV detection and high-resolution mass spectrometry (LC/Q-TOF) to identify and quantify the oligomeric states of liraglutide under varying pH conditions. The method was optimized to reveal pH-dependent transitions and to monitor time-dependent changes in oligomer populations.
Methodology
Sample Preparation
- Liraglutide stock at 2.0 mg/mL prepared in sodium phosphate buffers (pH 6.4, pH 7.0, pH 8.0) or 100 mM ammonium acetate for MS experiments.
- Incubation studies conducted over three days at controlled temperature with daily sampling.
- SEC/UV: Agilent AdvanceBio SEC 130 Å, 7.8 × 300 mm, 2.7 µm; mobile phase of 150 mM sodium phosphate or phosphate:acetonitrile:0.1 % arginine (9:25:65), flow rate 0.8 mL/min, 30 °C, detection at 280 nm.
- SEC/MS: Agilent AdvanceBio SEC 120 Å, 2.1 × 150 mm, 1.9 µm PEEK; 20 mM ammonium acetate, 0.07 mL/min, column at 30 °C; MS in positive ESI mode, m/z 100–10 000.
Used Instrumentation
- Agilent 1290 Infinity II bio LC system with high-speed pumps, multisampler with cooling, multicolumn thermostat, and diode array detector.
- Agilent 6545XT AdvanceBio LC/Q-TOF with Dual Jet Stream ESI source.
- Agilent OpenLab CDS v2.8, MassHunter LC/MS v11.0, and MassHunter BioConfirm v12.1 software suites.
Key Results and Discussion
SEC/UV analysis revealed that at pH 6.4 liraglutide predominantly forms higher-order oligomers (~12-mer), while at pH 8.0 lower-order oligomers (~3-mer) dominate. Calibration with protein standards confirmed column performance and allowed approximate molecular weight estimation. SEC/MS data showed freshly prepared samples rich in low-order species; prolonged incubation produced detectable high-order oligomer peaks in the mass spectra. Deconvoluted mass data from the LC/Q-TOF enabled unambiguous assignment of oligomer masses, demonstrating a mixture of 2- to 15-mer assemblies.
Benefits and Practical Applications
This combined SEC/UV and SEC/MS approach provides:
- High-resolution separation and quantitation of peptide oligomers under biocompatible conditions.
- Accurate mass identification of complex oligomeric assemblies.
- A workflow suitable for formulation screening, stability studies, and process monitoring in peptide drug development.
Future Trends and Opportunities
Further developments may include integration of multi-angle light scattering or fluorescence detection for absolute molecular weight determination, real-time monitoring of oligomer dynamics during manufacturing, high-throughput screening of buffer and excipient effects, and application to other lipidated or self-assembling therapeutic peptides.
Conclusion
A robust SEC workflow employing the Agilent 1290 Infinity II bio LC and AdvanceBio SEC columns, coupled with LC/Q-TOF mass spectrometry, effectively characterizes pH-dependent oligomeric states of liraglutide. The method offers valuable insights for formulation design, stability assessment, and quality control in biopharmaceutical peptide development.
References
- Nadkarni P.; Chepurny O. G.; Holz G. G. Regulation of Glucose Homeostasis by GLP-1. Prog. Mol. Biol. Transl. Sci. 2014, 121, 23–65.
- Dehsorkhi A.; Castelletto V.; Hamley I. W. Self-Assembling Amphiphilic Peptides. J. Pept. Sci. 2014, 20(7), 453–467.
- Brichtová E. P.; Krupová M.; Bour P.; Lindo V.; Gomes dos Santos A.; Jackson S. E. GLP-1 Aggregates into Low-Molecular-Weight Oligomers Off-Pathway to Fibrillation. Biophys. J. 2023, 122(12), 2475–2488.
- Bothe J. R.; Andrews A.; Smith K. J.; Joyce L. A.; Krishnamachari Y.; Kashi S. Peptide Oligomerization Memory Effects and Their Impact on the Physical Stability of the GLP-1 Agonist Liraglutide. Mol. Pharm. 2019, 16(5), 2153–2161.
- Wang Y.; Lomakin A.; Kanai S.; Alex R.; Benedek G. B. Transformation of Oligomers of Lipidated Peptide Induced by Change in pH. Mol. Pharmaceutics 2015, 12(2), 411–419.
- Kuo S.-T.; Xi Z.; Cong X.; Yan X.; Russell D. H. Dissecting Liraglutide Oligomerization Pathways via Direct Mass Technology, Electron-Capture Dissociation, and Molecular Dynamics. bioRxiv 2025.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
LC/MS Characterization of GLP-1 Receptor Agonist Oligomers and Other Elusive Impurities
2026|Agilent Technologies|Posters
Poster Reprint ASMS 2026 WP 604 LC/MS Characterization of GLP-1 Receptor Agonist Oligomers and Other Elusive Impurities Rachel Franklin Agilent Technologies, Inc., Corvallis, OR, US Introduction Experimental GLP-1 receptor agonists (GLP-1 RAs) are peptide therapeutics that can form impurities during…
Key words
liraglutide, liraglutideimpurities, impuritiesmonomer, monomerisomer, isomeroligomer, oligomeroxidation, oxidationprescreening, prescreeningsequencing, sequencingimpurity, impurityoligomerization, oligomerizationejection, ejectioninvestigation, investigationisomers, isomersnovo, novoaged
Workflow Solutions for Peptide Therapeutics - Application Compendium
2025|Agilent Technologies|Guides
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabimpurities, impuritiessemaglutide, semaglutidesynthetic, syntheticmsd, msdtherapeutics, therapeuticsnotes
Integrated Structural and Functional Characterization of a GLP-1 Analogue Using LC/MS and SPR
2026|Agilent Technologies|Applications
Application Note Biopharma/Pharma GLP-1 Functional assessment Structural characterization Integrated Structural and Functional Characterization of a GLP-1 Analogue Using LC/MS and SPR Authors Abstract Beatrice Sacripanti and Kyle Piccolo Nicoya Lifesciences, Inc. Glucagon-like peptide 1 receptor agonists (GLP-1 RAs) are a…
Key words
spr, sprliraglutide, liraglutidestructural, structuralpeptide, peptidefunctional, functionaloxidation, oxidationbinding, bindingnative, nativeoxidized, oxidizednicosystem, nicosystemcounts, countsreceptor, receptorcharacterization, characterizationassessment, assessmentchymotrypsin