Therapeutic Peptide Analysis of GLP‑1 Agonists
Applications | 2026 | Agilent TechnologiesInstrumentation
The analysis of therapeutic peptides, such as GLP-1 agonists, is critical for ensuring safety, efficacy, and regulatory compliance in biopharmaceutical development. Robust methods to confirm peptide identity, assess purity, and detect synthesis- or degradation-related impurities are essential for consistent manufacturing, supplier qualification, and quality control.
This study evaluates the performance of an Agilent Altura Peptide Plus column coupled to the InfinityLab Pro iQ Plus mass spectrometer for characterizing four GLP-1 analogs—semaglutide, liraglutide, retatrutide, and tirzepatide—sourced from multiple suppliers. Key goals include molecular weight confirmation and comparative impurity profiling to support supplier selection and quality consistency.
Sample Preparation:
Chromatography:
Mass Spectrometry:
Each peptide yielded a clear total ion chromatogram and deconvoluted mass spectrum.
Supplier comparison for liraglutide:
Tirzepatide sources also differed, with Supplier 1 displaying higher purity than Supplier 2.
The Altura Peptide Plus column and Pro iQ Plus platform deliver rapid, high-resolution separations and accurate mass confirmation. The workflow supports routine quality control, supplier qualification, and regulatory documentation for peptide therapeutics.
Emerging directions include integrating high-resolution MS for deeper impurity profiling, automating sample preparation, coupling peptide analytics with biological assays, and employing machine-learning algorithms to predict impurity formation and stability.
This application demonstrates a robust LC–MS approach for comprehensive analysis of GLP-1 agonists. The method reliably confirms molecular weight, distinguishes impurity patterns among peptides and suppliers, and supports quality consistency in biopharmaceutical production.
Colalto C. Aspects of Complexity in Quality and Safety Assessment of Peptide Therapeutics and Peptide-Related Impurities: A Regulatory Perspective. Regul. Toxicol. Pharmacol. 2024, 153, 105699.
LC/MS, LC/SQ
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Significance of the Topic
The analysis of therapeutic peptides, such as GLP-1 agonists, is critical for ensuring safety, efficacy, and regulatory compliance in biopharmaceutical development. Robust methods to confirm peptide identity, assess purity, and detect synthesis- or degradation-related impurities are essential for consistent manufacturing, supplier qualification, and quality control.
Objectives and Study Overview
This study evaluates the performance of an Agilent Altura Peptide Plus column coupled to the InfinityLab Pro iQ Plus mass spectrometer for characterizing four GLP-1 analogs—semaglutide, liraglutide, retatrutide, and tirzepatide—sourced from multiple suppliers. Key goals include molecular weight confirmation and comparative impurity profiling to support supplier selection and quality consistency.
Methodology and Instrumentation
Sample Preparation:
- Liraglutide, semaglutide, retatrutide, tirzepatide prepared at 1.0 mg/mL in DMSO or 30% acetonitrile.
Chromatography:
- Column: Agilent Altura Peptide Plus, 2.1×150 mm, 2.7 μm
- Gradient: 0.1% formic acid in water (A) and acetonitrile (B) over 15 min at 0.4 mL/min, 60 °C
- Injection: 5 μL, column oven 10 °C
Mass Spectrometry:
- InfintyLab Pro iQ Plus with Jet Stream ESI, positive mode
- Gas temps: 300 °C (drying), 250 °C (sheath); flows: 11 L/min (drying), 12 L/min (sheath)
- Capillary voltage: 3000 V; scan range m/z 200–3000; scan time 500 ms
Main Results and Discussion
Each peptide yielded a clear total ion chromatogram and deconvoluted mass spectrum.
- Semaglutide: single chromatographic peak and mass match, indicating high purity.
- Liraglutide: main peak plus five low-level impurities separated chromatographically.
- Tirzepatide: distinct main peak with three coeluting impurities detectable in deconvolution.
- Retatrutide: single peak obscuring two coeluting impurity species in the mass spectrum.
Supplier comparison for liraglutide:
- Supplier 2 showed the highest purity with no detectable impurities.
- Supplier 3 exhibited moderate impurity levels.
- Supplier 1 had multiple significant impurity peaks, indicating lower quality.
Tirzepatide sources also differed, with Supplier 1 displaying higher purity than Supplier 2.
Benefits and Practical Applications of the Method
The Altura Peptide Plus column and Pro iQ Plus platform deliver rapid, high-resolution separations and accurate mass confirmation. The workflow supports routine quality control, supplier qualification, and regulatory documentation for peptide therapeutics.
Future Trends and Potential Applications
Emerging directions include integrating high-resolution MS for deeper impurity profiling, automating sample preparation, coupling peptide analytics with biological assays, and employing machine-learning algorithms to predict impurity formation and stability.
Conclusion
This application demonstrates a robust LC–MS approach for comprehensive analysis of GLP-1 agonists. The method reliably confirms molecular weight, distinguishes impurity patterns among peptides and suppliers, and supports quality consistency in biopharmaceutical production.
References
Colalto C. Aspects of Complexity in Quality and Safety Assessment of Peptide Therapeutics and Peptide-Related Impurities: A Regulatory Perspective. Regul. Toxicol. Pharmacol. 2024, 153, 105699.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Workflow Solutions for Peptide Therapeutics - Application Compendium
2025|Agilent Technologies|Guides
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabsemaglutide, semaglutideimpurities, impuritiessynthetic, syntheticmsd, msdnotes, notestherapeutics
Peptide Drug Stability Analysis Using Agilent InfinityLab LC/MSD and OpenLab CDS Deconvolution
2024|Agilent Technologies|Applications
Application Note Biopharmaceuticals Peptide Drug Stability Analysis Using Agilent InfinityLab LC/MSD and OpenLab CDS Deconvolution Author Chae-Young Ryu Agilent Technologies, Inc. Abstract The Federal Drug Administration (FDA) abbreviated new drug application (ANDA) guidelines advise qualitative and quantitative management of peptide-related…
Key words
abundance, abundancecounts, countsliraglutide, liraglutideimpurities, impuritiessemaglutide, semaglutideinfinitylab, infinitylabrelative, relativemass, massmsd, msdpeptide, peptidecharge, chargedegradation, degradationdrug, drugmin, minanda
Characterization of Forced Degradation Impurities of Glucagon-Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry
2024|Agilent Technologies|Applications
Application Note Pharma & Biopharma Characterization of Forced Degradation Impurities of Glucagon‑Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract Peptide biotherapeutics have gained increased attention due to their many therapeutic uses. This application…
Key words
oxidation, oxidationcounts, countsmono, monoamu, amudeconvoluted, deconvolutedmass, masscharge, chargetirzepatide, tirzepatidetri, triliraglutide, liraglutidesemaglutide, semaglutidenative, nativeacquisition, acquisitionforced, forcedtryptophan
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg